KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_1212Help
Entry
Bdt_1212          CDS       T02356                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00010  Glycolysis / Gluconeogenesis
bbat00052  Galactose metabolism
bbat00500  Starch and sucrose metabolism
bbat00520  Amino sugar and nucleotide sugar metabolism
bbat00521  Streptomycin biosynthesis
bbat01100  Metabolic pathways
bbat01110  Biosynthesis of secondary metabolites
bbat01120  Microbial metabolism in diverse environments
bbat01130  Biosynthesis of antibiotics
bbat01200  Carbon metabolism
Module
bbat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bdt_1212 (glk)
   00052 Galactose metabolism
    Bdt_1212 (glk)
   00500 Starch and sucrose metabolism
    Bdt_1212 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Bdt_1212 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bdt_1212 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bdt_1212 (glk)
Enzymes [BR:bbat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bdt_1212 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FeoA
Motif
Other DBs
NCBI-ProteinID: AFY00911
UniProt: K7YM99
Position
complement(1281031..1281993)
Genome map
AA seq 320 aa AA seqDB search
MKKKTYTIGLDLGGTKLAAALLSDTGEMLDFIKVPVDMNREKSAPKAQKRLIQLMADIAL
DFKKRFPNETKASVFKGIGLASAGPLNAETGTLMNPANYPGWKIVPILDLLTKEIHKTWK
TPVYFQHDATAAALAEGWVGGAQKMKSFAIVTIGTGVGTGVIFNGLPGQSDGMGSEYGHI
VVDYQRLMKNPEKIDHCTVEGIASGTGLLRRAREMGFTGNSVEELIAANDAKYQVLFKEM
GWALAILCYNLSIGYNLEKIFLSGGLIKIRNMYLKDLKDHYKKMIRQSKTVFECPIEVAK
TQNHAGVIGAGFLPHLYGKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacctacaccatcggtcttgatctgggcggaactaaactggcagcggcg
ctgctttctgatactggcgaaatgctggatttcatcaaagttcccgtcgacatgaaccgc
gaaaagtctgcaccaaaagctcaaaagcgtctgattcagctgatggcagacattgctttg
gatttcaaaaaacgtttcccgaacgaaaccaaagcctctgtctttaaaggcattggtttg
gccagtgcgggtccattgaatgctgaaaccggcaccctgatgaatccggccaactatccc
ggctggaagatcgttccgatcctggatctgttgaccaaagaaatccacaaaacctggaaa
accccggtgtacttccagcacgacgccaccgcggcggctttggcggaaggctgggtgggc
ggcgctcagaaaatgaagtcctttgcgattgtcactatcggcaccggcgtgggcacaggc
gtgatctttaacggtctgccgggccagtctgacggcatgggctctgaatacggccatatc
gtcgttgattaccagcgtctgatgaaaaacccggaaaagatcgaccactgcacagtggaa
ggcattgcctctggcacgggtctgcttcgtcgtgcgcgcgagatgggcttcactggaaac
tcggtcgaagaactgattgccgccaacgatgccaagtaccaggtgctgttcaaggaaatg
ggctgggccctggctattctttgttacaacctttctattggctacaaccttgaaaagatc
ttcctgagcggcggtctgatcaagatccgcaacatgtatctgaaagacctgaaggatcac
tacaaaaagatgatccgccaaagcaagacggtctttgaatgcccgattgaagtggccaaa
acccagaatcatgcaggcgtgattggtgccggattcctgcctcacctttacggaaaaaag
taa

DBGET integrated database retrieval system