KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_1212Help
Entry
Bdt_1212          CDS       T02356                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bdt_1212 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bdt_1212 (glk)
   00052 Galactose metabolism
    Bdt_1212 (glk)
   00500 Starch and sucrose metabolism
    Bdt_1212 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Bdt_1212 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bdt_1212 (glk)
   00524 Butirosin and neomycin biosynthesis
    Bdt_1212 (glk)
Enzymes [BR:bbat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bdt_1212 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1281031..1281993)
Genome map
AA seq 320 aa AA seqDB search
MKKKTYTIGLDLGGTKLAAALLSDTGEMLDFIKVPVDMNREKSAPKAQKRLIQLMADIAL
DFKKRFPNETKASVFKGIGLASAGPLNAETGTLMNPANYPGWKIVPILDLLTKEIHKTWK
TPVYFQHDATAAALAEGWVGGAQKMKSFAIVTIGTGVGTGVIFNGLPGQSDGMGSEYGHI
VVDYQRLMKNPEKIDHCTVEGIASGTGLLRRAREMGFTGNSVEELIAANDAKYQVLFKEM
GWALAILCYNLSIGYNLEKIFLSGGLIKIRNMYLKDLKDHYKKMIRQSKTVFECPIEVAK
TQNHAGVIGAGFLPHLYGKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacctacaccatcggtcttgatctgggcggaactaaactggcagcggcg
ctgctttctgatactggcgaaatgctggatttcatcaaagttcccgtcgacatgaaccgc
gaaaagtctgcaccaaaagctcaaaagcgtctgattcagctgatggcagacattgctttg
gatttcaaaaaacgtttcccgaacgaaaccaaagcctctgtctttaaaggcattggtttg
gccagtgcgggtccattgaatgctgaaaccggcaccctgatgaatccggccaactatccc
ggctggaagatcgttccgatcctggatctgttgaccaaagaaatccacaaaacctggaaa
accccggtgtacttccagcacgacgccaccgcggcggctttggcggaaggctgggtgggc
ggcgctcagaaaatgaagtcctttgcgattgtcactatcggcaccggcgtgggcacaggc
gtgatctttaacggtctgccgggccagtctgacggcatgggctctgaatacggccatatc
gtcgttgattaccagcgtctgatgaaaaacccggaaaagatcgaccactgcacagtggaa
ggcattgcctctggcacgggtctgcttcgtcgtgcgcgcgagatgggcttcactggaaac
tcggtcgaagaactgattgccgccaacgatgccaagtaccaggtgctgttcaaggaaatg
ggctgggccctggctattctttgttacaacctttctattggctacaaccttgaaaagatc
ttcctgagcggcggtctgatcaagatccgcaacatgtatctgaaagacctgaaggatcac
tacaaaaagatgatccgccaaagcaagacggtctttgaatgcccgattgaagtggccaaa
acccagaatcatgcaggcgtgattggtgccggattcctgcctcacctttacggaaaaaag
taa

DBGET integrated database retrieval system