KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_1811Help
Entry
Bdt_1811          CDS       T02356                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00071  Fatty acid degradation
bbat00280  Valine, leucine and isoleucine degradation
bbat00281  Geraniol degradation
bbat00310  Lysine degradation
bbat00362  Benzoate degradation
bbat00380  Tryptophan metabolism
bbat00410  beta-Alanine metabolism
bbat00640  Propanoate metabolism
bbat00650  Butanoate metabolism
bbat00903  Limonene and pinene degradation
bbat00930  Caprolactam degradation
bbat01040  Biosynthesis of unsaturated fatty acids
bbat01100  Metabolic pathways
bbat01110  Biosynthesis of secondary metabolites
bbat01120  Microbial metabolism in diverse environments
bbat01130  Biosynthesis of antibiotics
bbat01200  Carbon metabolism
bbat01212  Fatty acid metabolism
Module
bbat_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bdt_1811
   00650 Butanoate metabolism
    Bdt_1811
  Lipid metabolism
   00071 Fatty acid degradation
    Bdt_1811
   01040 Biosynthesis of unsaturated fatty acids
    Bdt_1811
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bdt_1811
   00310 Lysine degradation
    Bdt_1811
   00380 Tryptophan metabolism
    Bdt_1811
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bdt_1811
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bdt_1811
   00281 Geraniol degradation
    Bdt_1811
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bdt_1811
   00930 Caprolactam degradation
    Bdt_1811
Enzymes [BR:bbat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Bdt_1811
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bdt_1811
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Bdt_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFY01500
UniProt: K7YXR6
Position
1912522..1914675
Genome map
AA seq 717 aa AA seqDB search
MSIQESIKIVPQGEVAVVEFDLVGEKVNKFSTPVMMRLKEVVEELKKSSYKAVIFKSNKP
KIFIAGADIEEIKSMTKAEEFEAAVKGGQEVISMVEDLPMPTIAAVNGACMGGGCEFILA
CDYRIASEDSSTKIGLPEIQLGILPGFGGCIRLPRVIGLQAALDIILAGKSVNSKKALKL
GLVDKVVHANLLESFSLKWAKEIIADGAKKRRKTFKPQGAVNVILESALGRSIVFKKARE
GVLKATKGHYPAPLQALEVIQKTYGMSDRDAALRVEREGFCKLGVTDISKNLIHVFYLTE
MVKKQNGVTGVDVKPRDVKGLGVLGAGTMGGGIAYVAADKGIQVRMKDLNTDALGKGLKH
ASDLWMKLVKRKSIDKYQFQQKMDLVSVSTDYAGFKNLDVVVEAIVEDMGVKQKVIGECA
GQMRPDAIIATNTSSLSVTEMAKGHPRPEYFAGMHFFNPVNKMPLIEVIRGEKTSDETIA
TIYELSKKMGKMPVVVKDGPGFLVNRLLLPYMGEAAFLLQEGMSIEFVDKVYVKEFGMPM
GPFELMDEVGLDVCLKVLKIFKKAFGERIELAACMEALGNSGRLGRKNGKGFYTYGEDGK
RGAVDQTVYAALGLGQPTNPYDGKECIERGVFAMINECSLALVEDRIVETPHEVDLAMIM
GTGFPPFRGGLMKYTDSIGTQYVADQLAMYASSRKAARLKPATPLTNMAKSNSKFYK
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcaggaaagtattaaaattgttcctcagggtgaggttgctgttgttgagttt
gatctggtgggggagaaagttaataagttctctacgccggtgatgatgcgccttaaggaa
gttgttgaggagttgaagaagtcctcgtacaaggctgttatttttaaatccaacaaaccc
aagatctttattgcgggtgcggatattgaagaaatcaaaagcatgaccaaggctgaagaa
tttgaagctgcggtgaagggtggtcaggaagttatcagtatggttgaagacctgccgatg
ccgacgattgctgctgtcaatggggcttgtatgggcgggggttgtgaattcatcctggct
tgtgattaccgtattgcttctgaggattcttccacgaaaattggtttgccggaaattcaa
ctgggcatcctgcctggttttggtggttgtattcgtctgcctcgcgtgattggtttgcag
gcggctttggatattatcctggctggtaagtctgtgaattccaaaaaggctttgaaactt
ggtctggtggataaagttgttcacgcgaacctgcttgagtccttctctttgaaatgggcg
aaagaaatcatcgcggatggcgctaagaaacgtcgtaaaacattcaagccacaaggggct
gtgaatgtgattctggaaagcgctttgggtcgcagcattgtctttaagaaagcccgtgag
ggtgtgttgaaggcgacgaagggtcattatccagcacctttgcaggcgttggaagtgatt
cagaaaacttatggtatgtctgatcgcgatgcggctttgcgtgtagagcgtgaaggcttc
tgcaagctgggtgtgactgatatttccaaaaacctgatccacgttttctatttgaccgag
atggtgaaaaaacaaaacggtgtgacgggtgtggatgtaaagccacgcgatgtgaaaggt
cttggtgttttgggtgctggcaccatgggtggcggtattgcttacgtggcggcagacaag
ggcattcaggttcgcatgaaggacttgaacaccgatgcgctgggtaagggtttgaagcac
gccagcgatctttggatgaaacttgtgaaaagaaaatccatcgacaagtatcagttccag
caaaaaatggatctggtgtctgtttccactgattacgcaggtttcaaaaatctggatgtt
gtcgttgaagccatcgttgaagacatgggtgttaagcaaaaagttataggtgagtgcgca
ggtcaaatgcgtcctgacgccattatcgcgaccaacaccagctccctgtctgtgactgaa
atggccaaaggtcatccacgtccggagtatttcgcgggtatgcacttcttcaatccggtg
aataaaatgccattgatcgaagtcatccgtggtgaaaagacttctgacgaaacaattgca
actatttacgagctgtccaaaaaaatgggcaagatgccagtggtggtaaaagacggtccg
ggcttcctggtgaatcgtttgcttttgccttacatgggcgaagcggcgttcttgcttcag
gaaggcatgagcatcgaattcgtcgacaaggtttacgtgaaagaattcggtatgccgatg
ggtccatttgaattgatggatgaagttggtttggatgtttgtttgaaggttcttaaaatc
ttcaaaaaagccttcggcgagcgtatcgagctggcggcttgtatggaagctctggggaat
tccggtcgcctgggtcgtaagaacggcaaggggttctatacatacggtgaagacggtaag
cgtggcgctgtggatcagactgtgtatgcagctttgggtctgggtcagccgaccaatcca
tacgatggcaaagagtgcatcgagcgtggtgtctttgcgatgatcaatgagtgctctttg
gcgctggttgaagatcgtatcgtggaaactccgcacgaagtggatctggcgatgatcatg
ggtacgggcttcccgccgttccgtggtggtctgatgaagtacaccgacagcattggcact
cagtatgtggccgaccagctggcgatgtacgcttccagccgcaaagcagctcgcctgaaa
ccggcgactccgctaacgaacatggcaaaatcaaacagcaagttctacaaatag

DBGET integrated database retrieval system