KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2029Help
Entry
Bdt_2029          CDS       T02356                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Brite
Enzymes [BR:bbat01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Bdt_2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2129374..2129985)
Genome map
AA seq 203 aa AA seqDB search
MIEFYTASTPNGRKVTIMLEELGLAYNLHKVNLKDLEQKKPEFLALNPNGKIPTIIDNKG
PEGQTTVFESGAILYYLAEKHGKFLGASLPEKTRTLQWVMFQMSAIGPIFGNYYYGLNTL
TPHNPGFIERFEKEAHRLVGVMEIQLSGNKYLAGESYTIADMVTYPWVAGFIHAQPGWFE
DKPSVKRWAELVGARPAVQKAMA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttttacaccgcctccacccccaacggccgcaaagtgaccattatgctggaa
gagctgggccttgcctacaatctgcacaaggtgaacttgaaggatctggagcaaaaaaag
cctgagttcctggcgctgaatcccaatggaaagatcccgacaatcatcgacaacaagggg
ccggaagggcagacgaccgtttttgaaagcggagctattttgtactatctggctgaaaag
cacggaaagttcctgggtgcgtctttgccggaaaaaacccgcactttgcagtgggtgatg
ttccagatgtcggcgatcggtccgatctttgggaactattactatgggctgaatacgctg
actccgcacaatccgggttttattgagcgctttgaaaaagaggcgcaccgcctggtgggc
gttatggaaattcagctttccggaaacaagtatctggcgggtgaaagttataccattgcc
gacatggtgacctatccatgggtggcgggctttattcacgcccagccgggttggtttgaa
gacaagccgtctgttaaacgctgggccgagctggtgggggcgcgtcctgcggtccagaag
gccatggcctaa

DBGET integrated database retrieval system