KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2451Help
Entry
Bdt_2451          CDS       T02356                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbat00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:bbat02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2586338..2587420
Genome map
AA seq 360 aa AA seqDB search
MLLLTPALTLILCACAHTNNEKKTSLHGTVVQSSSSYVSNLPARGIDYSAKIERVAFGSC
ANQDEPQPIWKTIAATHPDLFLFTGDNIYASWSGQQPIAEQYRKLDLVPEYRAVREKVPF
MATWDDHDFGQRDGGVDWTGKDAARRDFMNYWTYTRNSMPLEQGGVYHSKIIGPKKQTVQ
VIMLDTRYYRSPLKERPGFEGKAMNYIPQDEGTILGQHQWEWLETQLKRPADVRFIVSSI
QLIANDPQFEKWGNFPKERQRFFDLVKSTRAKNVIVISGDRHIASIAKTDLNGYGPIYDV
TASSLNRPNKYPDSDTHYVGATYNQENFGLAEIDWKKKTVSLQIRDMDSKVVNSVEIKLK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgacccccgctttgacgctgattctttgcgcctgcgcccatacaaacaac
gaaaagaaaacttccctccatggcaccgtggtgcagtcctccagcagctatgtttccaac
cttcctgcacgcgggattgattattccgccaaaattgaacgtgtggcttttggttcctgc
gcgaaccaggatgaaccgcagccgatctggaaaaccatcgctgccactcatccggatctg
ttcctgttcacaggtgataacatctatgccagctggtcaggacagcagcccatcgccgaa
cagtaccgcaagctggatctggtcccggaataccgcgcggttcgcgaaaaggttccattc
atggcgacctgggatgatcacgattttggccagcgcgacggtggtgtggattggaccggc
aaagatgccgcccgtcgtgatttcatgaactattggacctacacccgcaacagcatgccg
ctggagcaaggtggcgtttatcacagcaaaatcatcggaccgaaaaaacaaacggttcag
gtgatcatgctcgatactcgttattaccgcagtccactgaaagaacgcccgggtttcgaa
ggcaaagccatgaattacatcccccaggatgagggcaccattctgggccaacatcagtgg
gaatggcttgaaacccagttgaaacgtcccgccgatgtgcgctttatcgtcagcagcatt
cagctgattgccaacgatccgcaatttgaaaaatgggggaacttcccaaaagagcgtcaa
agattctttgatctggtaaaatccacgcgtgccaagaacgtgattgtcatcagcggcgac
cgtcatattgcttccatcgcaaaaacagacctgaacggttacggtccgatttacgatgtt
acggcaagctccttgaatcgcccgaacaaatacccggattcagacactcactatgtgggg
gcgacctataatcaggaaaacttcggcctggccgaaatcgactggaaaaagaaaaccgtc
tccctgcagattcgtgacatggacagcaaggttgtgaactctgtcgaaatcaaattgaaa
tag

DBGET integrated database retrieval system