KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2533Help
Entry
Bdt_2533          CDS       T02356                                 

Gene name
pcm
Definition
L-isoaspartyl protein carboxyl methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Brite
Enzymes [BR:bbat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bdt_2533 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2679815..2680492)
Genome map
AA seq 225 aa AA seqDB search
MGLSLEHYQQGVLKRALPLSEKVVEAFYSQPRHVFVPEYTVEEAYEDHPLVLFNSPPFVS
TISQPSFVLRILDLLKLEPGQKVFELGTGSGWNTAMMAEIVGKEGKVVSVEVIEELAVRA
RKILSERHLSQVIVKAGDGFEGDTANGPYDRVIFTAGSSEFPQKVFAQLKESGWMVFVRK
TQGSPDMLELIHKVGSEPHVVTSVPCSFVSVVREKTGPDSKEHSL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtcattggaacactatcaacaaggtgtcttgaagcgcgcattgccactgtct
gaaaaagtggtagaggctttttacagtcaaccacgccacgtcttcgtgccggaatacaca
gtggaagaggcctacgaagatcatcccttggtgcttttcaacagtccgccttttgtatcc
actatttcccaacccagcttcgttctgcgcattctggatctgctcaaacttgaacccggt
cagaaagtatttgaactgggtacgggcagcggctggaacacagcgatgatggccgagatc
gtcggcaaagaaggcaaagtggtgtcagtcgaagtgatcgaggagcttgcagtgcgagcc
cggaagatcctgagcgaacgtcacctgtctcaggtgatcgttaaagcgggggatggcttt
gaaggcgataccgccaacggtccgtatgaccgggttatattcacggccggatcgtccgag
tttccacagaaagtgtttgcgcaattgaaggaatccggatggatggtgtttgtgcgtaag
acacagggatcaccagatatgctggagctgattcacaaggtgggctcagagccgcatgtt
gtgacgtcagtgccttgttctttcgttagtgtggtccgggaaaaaacggggcctgattcg
aaagaacacagtctttga

DBGET integrated database retrieval system