KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2561Help
Entry
Bdt_2561          CDS       T02356                                 

Gene name
choD
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2715686..2717377
Genome map
AA seq 563 aa AA seqDB search
MGFFRSEQAEAEPKTQNVNLTMNYTRLADSAAELENFYEVLIIGSGYGGSVMAARLSRHH
QVVILERGREWVPGEFPETFQQMKSNLYCETHPLGLYSYHTHRDIDVMCGSGLGGTSLIN
AGVVIAPDRELFQKKGWPEEIQKSAQKGHFESYYQRVENMLNAQSYDPSRMRIHKANNLK
NSSDELGDPFHWAHIAVNIHGSHRTPLGDRQPKCHMCGNCSTGCNTGAKNTLNMNYLPLA
KKNGARIFTQMQVSHIEKNRQGNYLVRGTRISGRDKKPFSIEARNVIVSAGTMGSNQILL
RSQKWGHLQLSPLLGRHFSGNGDLLGLGFNGRQATDMLGNSSARIYRPDMISGATIYGIA
EYRQRKNIFERYLIEEGNIPGALVQIARRLTTFVKAQTSPSKIYRAWIDFINSKDVEKGS
LNHSMVYFGMGHDRAEGRLQLDHANRAVVHWPGVQQDPIFKRMIAKIKQHVAVNDATYVK
NPRSTILGGNNLITVHPLGGCGMGDSVQTGVVNHLGQVFHRDGSLYPGLFVMDGSVIPTA
VGVNPLLTISALAERAAENMELR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
ttgggcttttttcgcagcgaacaggccgaagccgagcccaaaacccagaacgtcaacctg
accatgaactacacgcgtctggccgattccgcagccgaacttgaaaacttttacgaagtt
ctgatcattggttccggctacggcggttcggtgatggcggcgcgattaagccggcatcac
caggtcgtcattttagagcgagggcgcgaatgggtccccggagaatttccggaaacattt
cagcaaatgaaatccaacctttactgcgaaacccatcccctgggactttattcctatcac
acccatcgcgacattgatgtcatgtgcggcagtggccttggtggaacctccttgattaat
gcgggcgtcgtgattgctccggatcgtgaactgtttcagaaaaaaggctggccggaagaa
attcaaaaatcagcccaaaagggccactttgaaagttactatcaacgcgttgaaaacatg
cttaatgcccagtcttacgaccccagtcgcatgcgcattcataaagccaacaatctaaaa
aacagcagcgatgaactgggtgatccttttcattgggctcatatcgccgtcaacattcat
ggcagccatcgcaccccgctcggggaccgtcagcccaaatgtcatatgtgcggaaactgc
agcaccggatgcaacaccggcgccaaaaacaccctgaacatgaactaccttcccctggcc
aaaaaaaatggcgcccgcatcttcacccagatgcaagtcagtcatatcgaaaaaaaccgc
cagggaaattatctggttcgcggcacccgcatcagtgggcgcgacaaaaagcccttcagc
attgaagcccgcaacgtgattgtttctgcgggaaccatgggttcaaatcagattttactg
cgttcgcagaaatgggggcacctgcagctgtcccctctgctagggcggcatttttcgggc
aatggtgacttgctgggcctgggcttcaacggccgtcaagccactgacatgcttggcaac
agcagtgctcgcatctatcgtccggacatgatttccggcgcgactatctatgggatcgcc
gaataccgccagcgaaagaatattttcgaacgctatctgattgaagaaggcaacattccc
ggggccctggtacaaatcgccagacgcctgaccacttttgtcaaagcccagacatcgccg
tcaaaaatctaccgggcgtggattgattttatcaacagcaaggatgtggaaaaaggttcg
ctgaatcattctatggtgtatttcggaatgggccatgaccgggccgaaggccgtctgcaa
ctggatcacgccaatcgggccgtggttcactggccgggagtacaacaagatccgatcttc
aagcgcatgatcgccaaaataaaacagcatgtcgcggtcaatgacgccacctacgtcaaa
aatccccgctcaacaattctgggcggcaataacctgatcacagtgcacccgcttggaggc
tgcggcatgggtgattcagttcagaccggtgtcgtcaatcatctggggcaggtttttcac
cgggacggatcgctgtacccgggattgtttgtcatggatggatcagtgattccaacagct
gtgggcgtgaatccactgttgacgatttcggccctcgcagaaagggccgcggaaaatatg
gagctgcgctag

DBGET integrated database retrieval system