KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2744Help
Entry
Bdt_2744          CDS       T02356                                 

Gene name
adh
Definition
alcohol dehydrogenase I
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bdt_2744 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bdt_2744 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Bdt_2744 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bdt_2744 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bdt_2744 (adh)
   00626 Naphthalene degradation
    Bdt_2744 (adh)
Enzymes [BR:bbat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bdt_2744 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2897667..2898665
Genome map
AA seq 332 aa AA seqDB search
MFAARYVPGKKELSLVDIPKPTPGPLDVILKVRAAGICHSDLHVLHGEVPYKETFTMGHE
ACGEVVEKGSEVTGTFNAGDLYAVHGPNPCGHCNYCRTGHDNLCNDPSRTFIGLGQDGAY
AEYLKVPARNIVKVPKGISPEVAAVATDAVLTPYHAIKTKGGVGLGSKMLAIGLGGLGMN
GVQIALALGAEVTAVDLKDANLEMAKSFGVQNVLNSKQISSLKPLSYDVVVDFVGLESTF
KDAQNLVKPGGTILLIGLGSAQVPLTTATAITFETKVQASFWGTHVEMQELYALIAEGKI
KPQVQTAPMKEVNHWLHELEAGRIKSRMALLP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcagcaagatacgtccctggaaaaaaagaactttcccttgtcgatattcccaaa
ccaaccccaggtccgctggatgttatccttaaagtccgtgcggcaggcatttgccattct
gaccttcacgtcctgcacggcgaagtcccttacaaagaaaccttcaccatggggcatgaa
gcctgcggtgaagtggtggaaaaaggttcggaagtcactggcactttcaatgccggtgat
ctttacgctgttcacgggcccaacccttgtgggcactgcaactattgccgcacgggtcac
gacaatctttgtaatgacccgagcagaacctttatcggtctgggacaagacggtgcctat
gctgaatacctgaaagttcccgcacgcaatatcgtgaaagtccctaaaggtatcagtcca
gaggtcgcggctgtggcgaccgatgcagtgttaacaccttatcacgctatcaaaaccaag
ggcggtgtcggcctgggttcaaaaatgctggctattggcttgggcggtcttggcatgaac
ggtgttcagattgctttggctttaggggccgaggtcaccgccgtggatttaaaagatgcc
aatctggaaatggccaaatcttttggcgtgcagaatgttttaaactccaagcagatctct
tcactgaagcccctgtcttatgatgtggtggtggattttgtgggccttgaatcaacattc
aaagatgcccagaacttggtaaaacccgggggcaccattctgctgatcggtttggggtct
gcacaagtgcccctgacaacggctacggccatcacctttgaaaccaaagtgcaggcatcc
ttctggggcacccacgttgaaatgcaggagctttatgcactgatagcggaaggaaagatc
aaaccgcaggtgcaaacagccccgatgaaggaagtgaatcactggctgcacgagctggaa
gccggacgaatcaagtcccgcatggctttgctgccataa

DBGET integrated database retrieval system