KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2996Help
Entry
Bdt_2996          CDS       T02356                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bdt_2996
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bdt_2996
Enzymes [BR:bbat01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Bdt_2996
Lipid biosynthesis proteins [BR:bbat01004]
 Desaturase
  First
   Bdt_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3166054..3167160
Genome map
AA seq 368 aa AA seqDB search
MTKKRIEWPVALFLVLNPLITLILAPIYFYNFGFQWDILLFALIFAAATNLGITAGYHRL
FSHKSYDAHPLVKALFLLVGASAFQGSALKWSSDHRRHHTHIDGEKDPYNINEGFWYAHM
GWMFFKDSVDQKIHAPDLEKDWMVKFQNDHYVPIAILTGFIFPMLVGWAMGSWLGGLVIA
GGLRIALTQQSTFFINSLCHTLGKQTYSKEISARDSWFVAILTHGEGYHNFHHKFQIDYR
NGIKWYHWDPTKWVIRTLSAMGLATKLRQISNVEILKARLQAEAAELTKHGFAEEKLAQM
KEKILEAQNKMKKLREDYEQFKLDAVRKREELKEAYDHKLEELRRDMEIAKLEFQMGMKQ
WRVYLRSV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacgtattgaatggccagtggctttatttttggttctaaacccactgatc
actctcatcctggctcccatttacttctacaacttcggcttccaatgggacattcttctt
ttcgctttgatttttgctgcggctacaaatctgggtattactgcgggttatcaccgtttg
ttctctcataaaagctacgatgctcacccactggtaaaagctctgttccttttggtcggt
gcttccgctttccagggttctgcattgaaatggtcctccgatcaccgtcgtcaccacaca
cacattgacggcgaaaaagatccttacaacatcaacgaaggcttctggtacgcccacatg
ggctggatgttcttcaaggactctgtagatcagaaaatccacgctccggatcttgagaaa
gactggatggtgaaattccaaaacgatcactatgttccaatcgcgatcctgacgggcttc
atcttcccgatgctggtgggctgggcgatgggctcttggttgggtggtctggtgatcgca
ggtggcctgcgcatcgctttgactcaacaatccactttcttcatcaactctctttgccat
actttgggcaaacagacttattccaaagaaatctctgcccgtgactcttggttcgtggcg
attctgactcatggtgagggttaccataacttccaccacaagttccagatcgactaccgc
aacgggatcaaatggtaccactgggatccaactaaatgggtgatccgcactttaagcgcc
atgggtctggcgaccaagcttcgccagatctctaacgttgagattcttaaagcccgcctg
caggctgaagcagccgaactgaccaaacacggtttcgctgaagaaaaactggcacaaatg
aaagaaaagatcctggaagcgcagaacaaaatgaagaaactgcgcgaagactatgaacag
ttcaagttggatgctgttcgcaaacgtgaagaactgaaagaagcttacgatcacaaactg
gaagaacttcgccgtgacatggaaattgccaaactggaattccagatgggcatgaaacaa
tggcgcgtgtatctgcgctctgtctag

DBGET integrated database retrieval system