KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3350Help
Entry
Bdt_3350          CDS       T02356                                 

Gene name
speB
Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Brite
Enzymes [BR:bbat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Bdt_3350 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3564625..3565560)
Genome map
AA seq 311 aa AA seqDB search
MEYKPLSGREFPRFSAIKTFFRLPYVSIEADYEVGIFGIPYDGGVSYRPGGRFAPAKVRD
VSSLGRGFHMTRMENFFENLKVADIGDCPTVPIDQKQTYEKIEKFVGEVLSHNKRFLAVG
GDHSTTLPVLRALRKKYGKPLAFIHFDAHLDTYPAAWGQEYHHGAFARHAVEEGLVDPKK
MVQIGIRGPLAGGDDLTFVNKHGIRVITVDEIRNQPITEFLKTLPTFDETPTYISYDIDN
LDPSCAPGTGTPVPGGLTTYEVQRIFRALKIPNLVGGDVVEISPPFDHADITALAGMDAL
FEMLHLFPIKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaaaccgttaagcgggcgcgagtttccgcgtttttctgcaattaaaactttc
ttcagattgccgtatgtttctatcgaagccgactatgaagtcgggatctttggtatcccg
tatgacggtggggtgtcttatcgtccgggcggccgttttgcaccggcgaaagtgcgtgat
gtttccagcttgggtcgtggcttccatatgacccgcatggaaaacttctttgaaaacctg
aaggtggccgacatcggcgactgtccaacggtgccgattgatcaaaaacagacttacgaa
aaaattgaaaagtttgtgggtgaggttctaagtcacaacaaacgtttcctggcagtgggc
ggggatcattccacgactttgccggtgctgcgtgctttaagaaaaaaatacggcaagcct
ttggcgttcattcactttgatgcgcacttggacacttatccggcggcctgggggcaggaa
taccatcacggggcatttgcccgtcacgcggtggaagaaggcctggtggatccaaagaaa
atggtacagattggtattcgtggcccgttggccgggggcgatgatctgactttcgtgaac
aaacacggtatccgtgtgatcaccgtggatgaaatccgcaatcagccaatcacagaattc
ctgaaaaccctgccgacgtttgacgaaactccgacttatatcagctatgacatcgacaat
ctggatccaagctgtgcgccgggtaccggcacgcccgttccggggggcctgacgacttac
gaagttcagcgcatcttccgtgcgttgaagattccgaatctggtgggcggcgacgtggtg
gagatttctcctccctttgaccacgctgacatcactgcgttggccggcatggatgctctt
tttgaaatgctgcacctgtttcccatcaagaagtaa

DBGET integrated database retrieval system