KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3379Help
Entry
Bdt_3379          CDS       T02356                                 

Gene name
cheB
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bbat02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bbat02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3596170..3597234)
Genome map
AA seq 354 aa AA seqDB search
MAQKIRVLIVDDSAVIRKLLEKIFSSCADIEVVGTASDPYIARDKLVALKPDVMTLDVEM
PRMDGISFLEKVMQHFPTRTIIFSSLAKTGSETYLRALEAGAIEIMEKPSIDVSQSLETL
SAAIIEKVKAVAKARINPIKAVVPNPGAPVQKIASTSLARTTHQLLAVASSTGGTEALKV
FLSGMPADIPGTLVVQHMPPGFTKSFAENLNKMFPFEVKEAEEGDQVVPGRVLIAPGNYH
MEITRSGAFYYVKLHQGPALHSVRPAADYLMKSVAKYVGKNAMGVVLTGMGKDGAEGLLE
MKNAGAYTVAQNEETCVVYGMPAAAVALGAADKVLPLDRIAGDLLKQLQTRNAA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaagattcgtgtccttattgttgatgattctgcggtgattcgtaagctgctg
gaaaaaatcttttcctcttgcgcggacatcgaagtggtgggaacagcatcggacccttac
atcgcccgtgacaagctggtggcgctaaagcccgacgtgatgactctggatgtagagatg
cctcgtatggatggcatcagcttcctggaaaaagtcatgcagcatttcccgacccgcacg
attattttttcaagcttggcaaagacgggctctgaaacttatctgcgcgctctggaagcc
ggagccatcgagattatggaaaagccgtccattgacgtgtcccagtccctggaaacactg
tcggcggcgatcattgaaaaagtaaaagccgtggcaaaagcccgtatcaatccgatcaaa
gcggtggtgcctaatccgggcgctccggtacagaagattgccagcacctctttggcgcgc
acgacgcaccagttgctggcggtggcctcgtccaccggtggtaccgaggcgctgaaggtg
ttcctaagcgggatgcctgcggatattccgggaactttggttgtgcagcacatgccaccg
ggtttcacgaaatcatttgctgaaaacctgaataagatgttcccttttgaagtcaaagag
gctgaagaaggggatcaggttgttccgggtcgagttctgattgctccgggcaactatcat
atggaaatcacgcgcagtggtgccttctattacgtgaagctgcatcagggtccggccctg
cacagtgttcgcccagctgcggactatctaatgaaatcagtggcgaagtacgtgggtaag
aatgccatgggtgttgttctgaccggtatgggcaaagacggcgctgaaggtcttctggaa
atgaagaacgctggtgcttacacggtggctcagaacgaagaaacctgcgtggtgtacggt
atgccggcagccgcagtagccttgggtgctgctgacaaggttctgccactggatcgcatc
gccggagacttgctgaaacagctgcagactcgtaacgccgcctag

DBGET integrated database retrieval system