KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3568Help
Entry
Bdt_3568          CDS       T02356                                 

Definition
(GenBank) hypothetical protein
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AHSA1 Polyketide_cyc2 Polyketide_cyc
Motif
Other DBs
NCBI-ProteinID: AFY03243
UniProt: K7YZR0
Position
3781067..3782020
Genome map
AA seq 317 aa AA seqDB search
MAAKSKSNEIKITRIYDAPVKAVWDAWTDPAQVAKWWGPRGFTITTHSKDLRPGGHWAYT
MHGPDGTNWENKTIYHEVVERSRLVYDHGGNDDRPPLFRVTATFQDVKGKTKLEMTMTLP
TPEAAQETKKFIKAAGGNSTWDRLAEYLEKESSGHETFVINRSFEAPINTVFEMWTNPEH
FAKWIPPTGFTMKFLRADIKTGGSTLCMMTNGQGVEFYSRAHYLEINRPDRIVYTQQFCD
KDEKPSRHPLAPTWPESMKTTVLLTEEAPDETRVTITWEAHGTWTKEELATFVQGRAGMT
QGWTGSFDKLEDLLAKE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaaaaagtaaatccaacgaaatcaaaatcacgcgaatttacgatgccccggtg
aaagccgtatgggatgcctggacggatcccgcccaagttgccaaatggtggggtccacgc
ggattcacaatcaccactcacagcaaagacctgcgccccggcggccattgggcttacacc
atgcatggacccgatggaaccaactgggaaaataaaaccatttatcacgaagtcgtagaa
cgttcgcgactggtgtacgatcacggaggcaacgatgacaggcctcctctgttccgtgtg
acggccacattccaggatgttaaaggcaaaaccaagcttgaaatgaccatgactttgcca
actccggaagcggcacaggaaaccaaaaagtttatcaaagctgctggcggcaattccact
tgggaccgtctggcggaatatctggaaaaagaatcttcaggccacgagacatttgtgatc
aaccgttcgtttgaagcaccgatcaacacggtatttgaaatgtggacgaatcccgaacac
tttgccaaatggattccaccgacggggttcaccatgaaattcctgcgtgcggatattaaa
actggcggcagcacgctttgcatgatgactaacggacagggcgtcgaattctatagtcgc
gctcattatctggaaatcaatcgcccggatcgcatcgtgtacacgcaacagttctgcgac
aaggatgaaaaaccatcccgtcacccactggcgccaacatggcccgaatccatgaaaacc
acggtgcttttgaccgaggaagctccggatgaaacccgagtcacaatcacctgggaagct
cacgggacttggacgaaagaggaactggcaacctttgttcagggccgcgccggaatgacg
caaggatggactggatccttcgacaaactggaagatttactggcgaaagagtaa

DBGET integrated database retrieval system