KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3618Help
Entry
Bdt_3618          CDS       T02356                                 

Gene name
recR
Definition
(RefSeq) DNA repair and genetic recombination protein
  KO
K06187  
recombination protein RecR
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bdt_3618 (recR)
DNA repair and recombination proteins [BR:bbat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bdt_3618 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3826875..3827450
Genome map
AA seq 191 aa AA seqDB search
MSRLPGIGPKTAQRLAYYILRTGNEYPERLSEALLRVKAEVHDCPTCFNYTDTDICRYCE
DSHRSDESICVVEEPSDIMRIESSGAFRGRYHVLHGAISPLEGIGPKELKIKELIDRVDD
GLNGTSPVIKEIILALDADLEGDTTILYLAKQLQGKGLKLSRIAHGVPIGSDIDFVDDRT
MGRALQNRVEL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgtctgcctggtatcgggccgaagactgctcagcgtctggcttattacattctg
cgtaccgggaacgaatacccggaacgtttgagtgaggcgcttttgcgcgtcaaggctgaa
gttcacgactgcccaacctgcttcaactacactgacacggatatctgccgctattgtgag
gattctcaccgttcggatgaatccatctgtgtggttgaagagccctccgacatcatgaga
attgaatcttcaggcgcgttccgtggccgctaccatgttttgcatggagcgatttctccg
ctggaaggcatcggccctaaagaattgaaaatcaaagagctgatcgaccgtgttgatgac
ggtttgaacggcaccagcccggttatcaaggaaatcatccttgcattggatgcggacctt
gagggcgacaccaccattttatacctggcaaagcagctgcagggcaaaggcttgaaactt
tctcgcattgcccatggagttcctattggcagcgacatcgatttcgtagatgatagaacg
atgggtcgcgccctgcaaaaccgcgtggagctgtaa

DBGET integrated database retrieval system