KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3618Help
Entry
Bdt_3618          CDS       T02356                                 

Gene name
recR
Definition
DNA repair and genetic recombination protein
Orthology
K06187  
recombination protein RecR
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bdt_3618 (recR)
DNA repair and recombination proteins [BR:bbat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bdt_3618 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3826875..3827450
Genome map
AA seq 191 aa AA seqDB search
MSRLPGIGPKTAQRLAYYILRTGNEYPERLSEALLRVKAEVHDCPTCFNYTDTDICRYCE
DSHRSDESICVVEEPSDIMRIESSGAFRGRYHVLHGAISPLEGIGPKELKIKELIDRVDD
GLNGTSPVIKEIILALDADLEGDTTILYLAKQLQGKGLKLSRIAHGVPIGSDIDFVDDRT
MGRALQNRVEL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgtctgcctggtatcgggccgaagactgctcagcgtctggcttattacattctg
cgtaccgggaacgaatacccggaacgtttgagtgaggcgcttttgcgcgtcaaggctgaa
gttcacgactgcccaacctgcttcaactacactgacacggatatctgccgctattgtgag
gattctcaccgttcggatgaatccatctgtgtggttgaagagccctccgacatcatgaga
attgaatcttcaggcgcgttccgtggccgctaccatgttttgcatggagcgatttctccg
ctggaaggcatcggccctaaagaattgaaaatcaaagagctgatcgaccgtgttgatgac
ggtttgaacggcaccagcccggttatcaaggaaatcatccttgcattggatgcggacctt
gagggcgacaccaccattttatacctggcaaagcagctgcagggcaaaggcttgaaactt
tctcgcattgcccatggagttcctattggcagcgacatcgatttcgtagatgatagaacg
atgggtcgcgccctgcaaaaccgcgtggagctgtaa

DBGET integrated database retrieval system