KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3653Help
Entry
Bdt_3653          CDS       T02356                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bdt_3653 (galF)
   00052 Galactose metabolism
    Bdt_3653 (galF)
   00500 Starch and sucrose metabolism
    Bdt_3653 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    Bdt_3653 (galF)
Enzymes [BR:bbat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bdt_3653 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3860702..3861586
Genome map
AA seq 294 aa AA seqDB search
MPRVKKAIIPAAGLGTRFLPATKTVPKEMLTIVDAPIILYVVEEAVKAGIEDIILIAGRG
KHAIEDFFDTSYELEDKLAKDGKEKLLERVTRIRDSANIISIRQKQAMGLGHAVLCGLPI
VGKEPFAVLLGDEITMGFHGEPNVTSQLVSSFEETGTSTISVMKVEDKDVSKYGIAEIEE
KSTGFFKVTSLVEKPKANETSSRWALPGRYVFDNAIMDILQNAKPTLNGEIQLTDSMKVL
CAQHGLNAMTFTAQRFDAGDKLGYLQANIELALQSPELNQELKSYILSLAEKLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagttaaaaaagccattattcccgctgccggcctcggaacccgtttcctgcct
gccaccaagactgtcccgaaagaaatgctgaccatcgtggacgctccgatcattctgtat
gtggtggaagaagcggtgaaagccgggatcgaggacatcatcctgatcgccggccgtggc
aaacacgccatcgaggatttctttgatacttcttacgagcttgaagacaagctggctaaa
gacggcaaagaaaaactgcttgagcgtgtgacccgcatccgtgattccgccaacatcatc
agcatccgccagaaacaagccatgggcctggggcacgcagtgctttgcggtcttccgatt
gtgggtaaagaaccgtttgcggttttgctgggcgatgaaatcaccatgggctttcacggt
gaaccgaatgtgacatcccaactggtcagctcttttgaagaaaccgggacttccaccatt
tctgtgatgaaagtggaagacaaggacgtttccaagtacggcattgctgaaatcgaggaa
aaatccacgggctttttcaaagtgacttctttggtggaaaaacccaaagccaatgaaacc
agcagccgctgggctcttccgggtcgttatgttttcgacaatgcgatcatggatattctg
caaaatgcaaaaccaaccctgaatggcgaaatccagctgaccgacagcatgaaggttctt
tgcgcccagcacggcctgaacgccatgactttcactgctcaacgttttgatgccggcgac
aagctgggttacctgcaggccaatatcgaactggccctgcaaagtccggagctgaatcag
gaattgaaatcctacattctaagcctggccgaaaaactgaagtaa

DBGET integrated database retrieval system