KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3653Help
Entry
Bdt_3653          CDS       T02356                                 

Gene name
galF
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
bbat00040  Pentose and glucuronate interconversions
bbat00052  Galactose metabolism
bbat00500  Starch and sucrose metabolism
bbat00520  Amino sugar and nucleotide sugar metabolism
bbat01100  Metabolic pathways
bbat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bdt_3653 (galF)
   00052 Galactose metabolism
    Bdt_3653 (galF)
   00500 Starch and sucrose metabolism
    Bdt_3653 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    Bdt_3653 (galF)
Enzymes [BR:bbat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bdt_3653 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Citrate_synt
Motif
Other DBs
NCBI-ProteinID: AFY03327
UniProt: K7ZHB7
Position
3860702..3861586
Genome map
AA seq 294 aa AA seqDB search
MPRVKKAIIPAAGLGTRFLPATKTVPKEMLTIVDAPIILYVVEEAVKAGIEDIILIAGRG
KHAIEDFFDTSYELEDKLAKDGKEKLLERVTRIRDSANIISIRQKQAMGLGHAVLCGLPI
VGKEPFAVLLGDEITMGFHGEPNVTSQLVSSFEETGTSTISVMKVEDKDVSKYGIAEIEE
KSTGFFKVTSLVEKPKANETSSRWALPGRYVFDNAIMDILQNAKPTLNGEIQLTDSMKVL
CAQHGLNAMTFTAQRFDAGDKLGYLQANIELALQSPELNQELKSYILSLAEKLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagttaaaaaagccattattcccgctgccggcctcggaacccgtttcctgcct
gccaccaagactgtcccgaaagaaatgctgaccatcgtggacgctccgatcattctgtat
gtggtggaagaagcggtgaaagccgggatcgaggacatcatcctgatcgccggccgtggc
aaacacgccatcgaggatttctttgatacttcttacgagcttgaagacaagctggctaaa
gacggcaaagaaaaactgcttgagcgtgtgacccgcatccgtgattccgccaacatcatc
agcatccgccagaaacaagccatgggcctggggcacgcagtgctttgcggtcttccgatt
gtgggtaaagaaccgtttgcggttttgctgggcgatgaaatcaccatgggctttcacggt
gaaccgaatgtgacatcccaactggtcagctcttttgaagaaaccgggacttccaccatt
tctgtgatgaaagtggaagacaaggacgtttccaagtacggcattgctgaaatcgaggaa
aaatccacgggctttttcaaagtgacttctttggtggaaaaacccaaagccaatgaaacc
agcagccgctgggctcttccgggtcgttatgttttcgacaatgcgatcatggatattctg
caaaatgcaaaaccaaccctgaatggcgaaatccagctgaccgacagcatgaaggttctt
tgcgcccagcacggcctgaacgccatgactttcactgctcaacgttttgatgccggcgac
aagctgggttacctgcaggccaatatcgaactggccctgcaaagtccggagctgaatcag
gaattgaaatcctacattctaagcctggccgaaaaactgaagtaa

DBGET integrated database retrieval system