KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_3762Help
Entry
Bdt_3762          CDS       T02356                                 

Definition
Beta-hexosamidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbat00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bdt_3762
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bdt_3762
Enzymes [BR:bbat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bdt_3762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3970941..3972617
Genome map
AA seq 558 aa AA seqDB search
MNKYIRGILRNFSFCLLILVFPHLVLASGPSADKLSKVIDFKIKQMSPEEKVGQLFIVGF
PHKNVAPDLESFIAKYKPGSFLLFKRNMISAPQIRELNLALYKASYKHSKLPPLIAIDQE
GGSVSRLPITPAPPNALALGQTQSPLLAEEMGYQTGLFLREVGFNMNLAPVLDVVDPYST
SFIGVRSFGSDPELVRDIGVAYSKGLLKARVIPTAKHFPGTGSLNQDPHLTVVKNSATLE
EMKRRDLIPFIGYSKIGANIAVMMSHLIYPGLDEDLEPASFSTKISKTLLRDELKYQGLV
MTDDLQMQGSKQVLRPEAAALRALQSGSDIVMLTWSFADQGKAFDYVLAALKSGDLPSAS
VDEKLRRILRVKAFANVYRRDPKLPSLLSGNSLTSPQYAEIEDEVLSQNLKTSLIPRQLP
SAKTPRKPASLETVCAASPSQDFLLSFVGTEKRKIPSLKLENSSLGKDLSALLSKNQCTA
LFVGVTGPRTARQVRGLSPQERQKLIVVNLGAPRLFPKSRGYRQVIQLYFNHRDAGKKIA
QYRDEILKSSQGSFALKD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtatatcaggggaatccttaggaattttagtttttgtctgctgattcttgtt
tttccccaccttgtactagcttctggtccttcggctgacaagctgtcaaaagtcatcgat
ttcaagatcaaacaaatgagtcctgaagaaaaagtcggacagcttttcatcgtcggcttt
ccccataaaaacgtcgctccggatctggaatcctttatcgcgaaatacaaacccggatca
ttcctgctatttaaacgcaatatgatttcagccccgcagattcgggagctgaatctggcg
ctttataaagcaagctacaaacattctaaacttccaccactgattgccatcgatcaggaa
ggtggatcggtatcccgcctgccgatcacgcccgctccgccgaatgcattggccctgggg
cagacccagtcccctcttttggcggaagagatgggctatcaaacaggactattcctgcgt
gaagtgggcttcaacatgaatcttgcgcccgtgctggatgtggtggacccctattcgaca
agcttcattggtgtcagatcctttggctcggatccggagctggtgcgcgacatcggtgtc
gcctattcaaaaggtcttcttaaagcgcgcgtgatccccacggcgaaacacttcccgggc
accggcagtctgaatcaggatccgcatctgacagtcgtaaaaaacagcgcgactttggaa
gaaatgaaaaggcgcgatttgattcctttcataggttattcaaaaatcggcgccaatatt
gcggtgatgatgtcgcatctgatttacccgggtctggatgaagatttagagcccgcaagt
ttttccacaaagatttccaaaactcttttacgtgatgaactgaagtaccagggcctggtc
atgaccgatgacttgcagatgcaaggatcaaagcaagtgctgcgcccggaagccgcggcc
ctgcgcgccctgcaatcggggtccgacatcgtgatgctgacatggtcttttgccgatcag
ggaaaggcttttgattacgtcttggcagccctgaaatccggcgaccttccatccgccagc
gtggatgaaaaacttcgccgtattttacgcgtaaaggcctttgcaaacgtttatcgcaga
gaccccaagctgccctccctgcttagtggcaacagcctcacgtcgcctcaatacgcagag
atcgaagacgaagttttatcccagaacttaaaaaccagcctgatcccaagacagctgccc
tcagcaaaaaccccgcgtaagcccgcgtcgctggaaactgtgtgtgccgcctcaccgtct
caggatttcttgctgtcctttgtgggcacggaaaaaagaaagatcccaagtctgaagctt
gaaaacagctcgttgggtaaggatctgtcggcattgttgagtaagaatcaatgcacggct
ttgtttgttggcgtcaccggtcctcgcaccgcccgtcaggtgcgtggtctttccccgcag
gaacgccaaaagctgattgtggtgaacttgggggcgcctcgcctgttcccgaagtcgcgt
ggctatcgccaggtcattcagctttactttaatcacagggatgccggcaaaaagatagcc
cagtaccgggatgaaatcttaaagagttctcaaggttcgtttgccttgaaagattag

DBGET integrated database retrieval system