KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00028Help
Entry
BIF_00028         CDS       T01840                                 

Definition
(GenBank) Hypothetical cytosolic protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1422855..1424357
Genome map
AA seq 500 aa AA seqDB search
MSLVYTGLVCSEEGNVLPLPISQAKELTMADSNVTESKTTDNAVANDEATTPAAAVPSPA
AMKAHAPSPAVLAKSPVAHLASSSSHDDVELKEAESFGRVDGNGTVYVKEGEEEREVGQF
PDASADEALALYARRYLDLKAKLDVFANRLKSNSIKPREIDETLAALTEEVKQPAVVGDI
PALQSQLEELRKKAAAKKDAIAKARKEAMTKAIAERTSIVEKAEALAAGLGDNTNWRSTA
DKFRSLFEQWQEHQRTTIRIDKAEADALWKRFSGARTTFNQARRKWAQARDAERSHAKAQ
KEAIIAEANEIKDSTAWGETSRKFNELMDRWKKAGRAGRNEDDALWAQFRAAADTFFNAR
QADREQISSNEKENLAQKEALLAKAEALVPVETGEQAKQARVKLAQIQEEWDQIGYVPRE
DMRRIEGRLDAVDNQIKAVEDAAWKKTDPEADARKSSFEGQLKAQLAELDEQIAKESDAK
KKAKLEAEKATKEQWLNAIM
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttgtctatactgggctagtgtgttccgaggaagggaatgtgcttcccctcccc
atctcgcaagctaaggagctgaccatggccgattccaacgtcaccgaatccaagaccaca
gacaacgcagtcgcgaacgacgaggcgacgacgccggccgcagccgtgccgagcccggcg
gccatgaaggcgcatgctccctcaccggccgttctcgccaagagccctgtggctcatctg
gcgtcatcgtcgtcacatgacgatgtagagctcaaggaggcggagagcttcggccgtgtg
gatggcaacggcaccgtatacgtgaaggagggcgaggaagagcgtgaggtggggcaattc
cccgatgcgtcggccgacgaggcattggccttgtacgcgcgccgttacctcgacctcaag
gccaaactcgacgtattcgcaaatagactcaagtccaattcgatcaagccccgtgagatc
gacgagacgctcgccgcgctgacggaggaagtcaagcagccggcggtcgtgggcgacatc
cccgcactccagtcgcagttggaagagctgcgcaagaaggctgcggcgaagaaggacgcc
atcgcgaaagcccgcaaggaggccatgaccaaggcaatcgccgaacgcacctccattgtg
gagaaggccgaggcccttgccgccggactgggtgataacacgaactggcgttccactgcc
gacaagttccgttcgctgttcgagcagtggcaggagcatcagcgcactacgatccgcatc
gacaaagccgaggcggatgctctgtggaagcgcttctcgggggcacgcaccaccttcaac
caggctcggcgcaaatgggctcaggcccgtgatgccgagcggtcccatgccaaggcgcag
aaggaggcgatcatcgccgaagccaacgaaatcaaggattccacagcttggggcgagacc
tcgcgtaagttcaacgaactcatggaccgttggaagaaggcaggccgtgccggccgtaat
gaggatgatgcactgtgggcacagttccgcgccgccgccgatacgttcttcaatgcgcgt
caggccgaccgtgaacagatcagctccaacgagaaggagaatctggcgcagaaggaggcg
ctgttggcgaaggccgaggcactcgtgccggtggagaccggggaacaggccaagcaggca
cgtgtcaagctcgcgcagattcaggaggagtgggatcagatcggctatgtgcctcgtgag
gacatgcgtcgcatcgaaggtcgtctggatgccgtggacaaccagatcaaggccgtcgaa
gatgctgcctggaagaagaccgatcccgaggccgatgcccgtaagtcgagcttcgaaggc
cagctcaaggcacagctcgccgagttggacgaacagatcgccaaggagtcggacgccaag
aagaaggcgaagctggaggccgagaaggcgaccaaggagcagtggctcaacgccatcatg
tga

DBGET integrated database retrieval system