KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00031Help
Entry
BIF_00031         CDS       T01840                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00260  Glycine, serine and threonine metabolism
bbb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01130  Biosynthesis of antibiotics
bbb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BIF_00031
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BIF_00031
Enzymes [BR:bbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BIF_00031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA GDPD
Motif
Other DBs
NCBI-ProteinID: ADC85810
UniProt: D3R4Y6
Position
1554527..1555474
Genome map
AA seq 315 aa AA seqDB search
MSRQPHSRRTVRPATTRERVSGIGADMTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDK
PAFIGYLPFGFPTMEQSLEAFATMVENGADIVEIGLPYSDPVMDGPVIQAASQIALNNGE
RIADVFKAVETVANAGGVPLIMSYWNLIYHYGVERFAADFANAGGAGLITPDLIPDEAGE
WIEASDRHGLDRIFLVSPDSTDERLRVVCENARGFVYAASRMGVTGERSSLGTSPEDLVA
RTRKAGAENVCVGIGVSTAAQGKAVGQYADGVIVGSALVHTLLTEDGDARELTSGLAALA
AKTAELAEGIHNARL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtgaacgagta
agtggaataggagcagatatgaccgaatacaacaccacgccaagcggtcagccgcttgga
atcagccatcgtcccagcccatgccgcgagctgttcacacggttcaaagcgcaggacaag
cctgcattcattgggtacctgccattcggattccccacgatggaacagtcactcgaggcc
ttcgccacgatggtcgagaacggtgctgacattgtcgagataggactgccgtattccgat
ccggtgatggatggcccggtgatccaggccgccagccagatcgccctgaacaatggcgag
cgcatagccgatgtgttcaaggccgtggagacggtggccaatgccggtggagtgccgctc
atcatgagctactggaacctcatctaccattatggggttgaacgcttcgccgctgatttc
gcgaatgcaggaggcgcaggccttatcactcccgatctcattcccgacgaggcaggggag
tggatcgaggcgtcggaccgccatgggctcgatcgcatcttccttgtttcccccgactcc
accgatgagcgtctgcgggtggtgtgtgaaaacgcccggggattcgtctatgcggcatcg
cgcatgggcgtgactggcgaacggtcgagtctagggacttccccggaggatcttgtggcc
cggacccgtaaggccggggccgagaatgtgtgtgtgggcatcggcgtctccaccgctgct
caaggcaaggccgtcgggcagtatgcagacggggtcatcgttggatccgccttggtccac
accctgctcaccgaggatggcgatgcgcgcgagctcacctcaggtctggctgcgttggcg
gccaagaccgcagaactcgccgagggcatccacaacgcacgcctgtag

DBGET integrated database retrieval system