KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00031Help
Entry
BIF_00031         CDS       T01840                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bbb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bbb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1554527..1555474
Genome map
AA seq 315 aa AA seqDB search
MSRQPHSRRTVRPATTRERVSGIGADMTEYNTTPSGQPLGISHRPSPCRELFTRFKAQDK
PAFIGYLPFGFPTMEQSLEAFATMVENGADIVEIGLPYSDPVMDGPVIQAASQIALNNGE
RIADVFKAVETVANAGGVPLIMSYWNLIYHYGVERFAADFANAGGAGLITPDLIPDEAGE
WIEASDRHGLDRIFLVSPDSTDERLRVVCENARGFVYAASRMGVTGERSSLGTSPEDLVA
RTRKAGAENVCVGIGVSTAAQGKAVGQYADGVIVGSALVHTLLTEDGDARELTSGLAALA
AKTAELAEGIHNARL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcagccgcactcgaggcgaacggtgcgaccggcaacaacgcgtgaacgagta
agtggaataggagcagatatgaccgaatacaacaccacgccaagcggtcagccgcttgga
atcagccatcgtcccagcccatgccgcgagctgttcacacggttcaaagcgcaggacaag
cctgcattcattgggtacctgccattcggattccccacgatggaacagtcactcgaggcc
ttcgccacgatggtcgagaacggtgctgacattgtcgagataggactgccgtattccgat
ccggtgatggatggcccggtgatccaggccgccagccagatcgccctgaacaatggcgag
cgcatagccgatgtgttcaaggccgtggagacggtggccaatgccggtggagtgccgctc
atcatgagctactggaacctcatctaccattatggggttgaacgcttcgccgctgatttc
gcgaatgcaggaggcgcaggccttatcactcccgatctcattcccgacgaggcaggggag
tggatcgaggcgtcggaccgccatgggctcgatcgcatcttccttgtttcccccgactcc
accgatgagcgtctgcgggtggtgtgtgaaaacgcccggggattcgtctatgcggcatcg
cgcatgggcgtgactggcgaacggtcgagtctagggacttccccggaggatcttgtggcc
cggacccgtaaggccggggccgagaatgtgtgtgtgggcatcggcgtctccaccgctgct
caaggcaaggccgtcgggcagtatgcagacggggtcatcgttggatccgccttggtccac
accctgctcaccgaggatggcgatgcgcgcgagctcacctcaggtctggctgcgttggcg
gccaagaccgcagaactcgccgagggcatccacaacgcacgcctgtag

DBGET integrated database retrieval system