KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00063Help
Entry
BIF_00063         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1343617..1344900
Genome map
AA seq 427 aa AA seqDB search
MKVLCAHGVAFVRAYDGVMAYDNGNVIDVRANTTLSTENAIKGNVLVLGNSGVGKSTLIN
AVIGDTVAKTSFGTRGTTSELAVYESPTVPFRVIDSIGFEPSPIKSLRAVHAVRKWSKAS
AKEGHEHNKIDVIWFCVDGTAAKLFPETIRNLSTAVSMWRSVPIITVITKSYSKPDRELN
VQMVRQAFAGQRMERNLRAIIPVVAQTYVIDETAFAGPEGISDLIDETMKAMPEGMRGGS
HDLMAFKLTRKRVLAQGLIGACVAAGATVGAVPIPIADSLVLSPLELGELHGLARLYGID
KDEGSKQFLDSIVQVGTASVVAHSAISAVKSIPGVNIAASVLNAIVAASIIAALGEGAVI
AFEQVYSGKRSVNDVTWVQNLMQEQFGEGFLGKVSGVAQASAKAGDAKDMREMIVELVKA
AFMNRGE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgctttgcgctcacggcgtcgcattcgtgcgtgcctatgatggcgtcatggca
tacgacaatggcaatgtgatcgacgtgcgggcgaacacgacgctgagcacggagaatgcg
atcaaaggcaacgtacttgtattgggcaactcgggtgtgggcaagtcgacgttgatcaac
gcggtgataggggacactgtggccaaaacgagcttcggcacgcggggcaccaccagtgag
ctcgccgtctatgagagcccaacggtgccgttccgggtcatcgattcaatagggttcgaa
ccgtctcccatcaaaagcctcagagcggtgcatgcggtgcgcaaatggtcgaaggcgagc
gccaaggaaggtcatgagcacaacaagatcgacgtgatctggttctgcgtggacgggaca
gcggcaaagctgttcccggagacaatacggaatctgtccacggccgtgtcgatgtggcgg
tcggtgccgatcatcaccgtgatcacgaaatcgtattcgaaaccggaccgcgagctgaat
gtgcagatggtgcggcaggcgttcgcggggcagcggatggagaggaacctgcgcgcgatc
atacctgtggtggcgcagacctatgtgatcgacgaaaccgcgttcgccggccccgaggga
atctccgatctcatagacgagacgatgaaggcgatgccggaggggatgcgcggtggctcg
catgatctcatggcgttcaaactcacccgcaaacgagtgctcgcgcaaggtctgatcggc
gcttgtgtggcggcgggtgccacagtgggcgccgtgccgattccaatcgccgactccttg
gtgctctccccgctggaactgggcgagttgcatggcctggcgcgactgtatggcatagac
aaggatgaagggtcgaagcagttcctggattccatcgtgcaggtgggcacggcaagcgtg
gtggcgcattccgcaatcagcgcggtgaaatcgattccgggcgtcaacatcgcggccagt
gtgctcaatgcgattgtggcggcgagcatcatcgccgcactcggtgagggtgccgtcata
gccttcgagcaggtgtacagcggcaagcgcagcgtgaacgacgtcacctgggtgcagaat
ctgatgcaggagcagttcggcgaagggttcctcggcaaggtgagcggtgtggcgcaggcg
tcggccaaggccggcgatgcgaaggacatgcgtgagatgatcgtggaattggtcaaggcc
gcgttcatgaatcggggggagtaa

DBGET integrated database retrieval system