KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00072Help
Entry
BIF_00072         CDS       T01840                                 

Definition
(GenBank) Hypothetical membrane associated protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1351191..1352423
Genome map
AA seq 410 aa AA seqDB search
MALIRAFAGALSGTFADQWLDIITVGQFDEHAVLMPGIYQETNRDRGSNTKHSEAVISNG
SRIYVPENTAAFIFDQSGIENIITESGGYEYRTGGTDSVFAGNGIGKSIFEQIGERFKYG
GEPVANKRIAFVNLREIRGIKFGTPAPLMYHDRFYQTDLEIRARGMMSVQVVNPLAFIRQ
FVPPNVDYISFDDPNTKSQILSEFMQSFSVALNSLSNEYRISALPSQANSIALAISGDSS
NAGTWESRFGLHLVGIGIESIEFTDESRELVKQYSSNRMNLSAYENISQQASNIAAQQKI
AEGVQQNGFGDMGGMMLGLGFAQGVNPMTGAMPGQSVPTQTNPAAAAAVAADAQGTVAQA
AAQPPAAQGTQSAMSVTEQMEALKSLKELLDAGILTQEEFNVKKRQILGL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcattgatcagagcattcgccggagcattgagcggcaccttcgccgatcaatggctc
gacatcatcaccgttgggcaattcgacgagcatgctgtgctcatgcccggcatctaccag
gagaccaaccgtgaccgcggctccaatacgaagcattcggaggcggtgatctccaacggt
tcacgcatctacgtgccggagaacacggccgcattcatcttcgaccagtccggcatcgag
aacatcatcaccgagtcaggcggttacgaataccgcaccggcggcaccgatagcgtgttc
gcaggcaacggcataggcaagtcgatcttcgagcagataggcgagcggttcaaatacggc
ggcgagccggtggcgaacaaacgcatcgccttcgtgaatctgcgtgagatccgcggcatc
aaatttggcacgccggcaccgctcatgtaccacgacaggttctaccagaccgatctggag
attcgtgcgcgtggcatgatgtcggtgcaggtggtcaacccgctcgcattcattcgccag
ttcgtgcctccgaacgtggactacatcagcttcgacgacccgaacacgaaatcgcagatc
ctctccgaattcatgcagtcgttctcggtggcgctcaactcgctgtcaaacgaataccgc
atctccgcgctgcccagccaggcgaattccattgcgctcgcgatctcaggggattcgtcg
aatgccggcacatgggagtcgcgtttcggtctgcacttggtgggcataggcatcgagagc
atcgaattcaccgacgaatcgcgtgagcttgtcaagcaatactcgtcgaaccgcatgaat
ctttcggcatacgagaacatctcgcagcaggcttcgaacatcgccgcgcagcagaagatc
gccgagggcgtgcagcagaacgggttcggcgacatgggtggcatgatgctcgggcttggt
ttcgcgcagggagtcaatccgatgaccggcgcgatgccggggcagtctgtgcctactcag
acgaatccggccgcggcagccgcagtggcagcggatgcgcagggcaccgtcgcgcaagct
gccgcacaacctccggctgcacagggaacgcaatccgccatgtcggtgacggagcagatg
gaggcgcttaagtcgctcaaggagcttctcgatgcgggaatccttacgcaggaggaattc
aatgtgaaaaagcggcagattctcggcctctag

DBGET integrated database retrieval system