KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00089Help
Entry
BIF_00089         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1349226..1350011
Genome map
AA seq 261 aa AA seqDB search
MSTSVLPRSADFIASSEDDMSASTPAVNRVPVARQTFRAPVAEVYAALVQTLHFSAGFDV
VANDDVTHSVRFRLPNDNGEYEARVIADGMHSAVIIEAPAGTAGGSAAYSRLYRELAEQI
VAQSTVVPHDVIAKRRFRQAIVADNDGPRSKWAIGAVVFACGALLGALAMFSDLRPDWQV
CVTLIVSLFVVCGIAFAVTGRNGKVSGRNLVLIAFAISCLASVLLLCATIVVQIRYSTTL
AISETMAQTASALPLEMPKQQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaccagcgtcttgcctcggtcagctgatttcatcgcatcctcggaagacgatatg
agcgcctcgactcccgccgtgaaccgtgtgcctgtggcgcggcagacattccgcgccccg
gtcgctgaagtgtacgccgcgctcgtccagacattgcacttcagtgcggggtttgacgtc
gtcgccaacgatgacgtcacgcattccgtgcgattccggctgccaaatgacaacggcgag
tacgaggcccgggtcatcgctgatggcatgcacagtgcggtgatcatcgaagctccggcg
gggacggcgggcggaagcgcagcctacagtcggctgtaccgagaattggccgaacagatt
gttgcgcagagcaccgttgtaccccatgacgtcatcgccaaacgcagattccggcaagcc
attgtcgcagacaatgatggtccgagatcaaagtgggcgattggtgccgtcgtcttcgca
tgtggtgcgctgctgggagcgttggcgatgttcagcgacctgcgtccggactggcaggtg
tgcgtcacgctcatcgtctcgctgtttgtcgtatgcggcatcgcgttcgcggttaccggc
cgcaacggtaaggtctccgggagaaatctggtgctgatcgctttcgccatctcctgcctg
gcatcggtgctgctgttatgcgcgaccatagtggtgcagatcaggtattctaccactctt
gcgatatccgagacgatggcgcaaacagcatcagcgctgcccctcgaaatgccaaaacaa
caataa

DBGET integrated database retrieval system