KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00107Help
Entry
BIF_00107         CDS       T01840                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbb01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bbb00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(111060..112460)
Genome map
AA seq 466 aa AA seqDB search
MSQDNYMRIIDLRGKELTRAEMLDAMPRAEMGTDEASEIVQPILDNVRENGAAALREYAE
KFDHIVPKSFRVPTDVMDAAVACLDPEVRAAIEESVRRARAVAKSQVPEDFHTDLAEGAR
VSERWIPIQRVGLYVPGGKAVYPSSVIMNVVPAQAAGVESLAIATPPSRDNAQGWPNKTI
LATCAILGVDEVYAVGGAQAIAMFAYGATDLDNPVSPVLCEPVDKITGPGNIFVATAKRL
VSGIVGIDAVAGPTEIAIIADKTSNPAYVAADLIGQAEHDELAGSVLITDDDQLAEAVQA
ELNKRVPRTEHSERVATSLSGKQSGIILTDGIEQSIDAANAYAAEHLEVQTADPDAVIAK
IRNAGAIFRGNYSPVPLGDYMSGSNHVLPTSGTARFAAGLGVHTFMKPVEVIEYDEQGLK
ELAARVNALAVSEDLPAHGESVLTRFIDDPYNKETITEQEEEAGLR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagataactatatgcgcatcattgatttgcgcggcaaggaactgacacgcgcc
gagatgcttgacgcgatgccacgagctgagatgggaaccgacgaagcgagcgagatcgtg
cagccgattctcgacaacgtgagggagaacggcgccgcagcgttgcgtgaatatgccgag
aaattcgaccacatcgtccccaagtcgttccgtgtacccaccgacgtcatggatgccgcc
gtggcgtgcctcgacccggaagtgcgcgcagcgattgaggaatccgtgcgccgtgcccgc
gcagtcgcgaaatcgcaggtcccagaggacttccataccgatttggctgagggtgcgcgc
gtcagtgagcgctggatcccgatccagcgtgtgggtctgtacgtgcccggcggcaaggcc
gtgtacccgagttccgtgatcatgaacgtggtgccggcacaggccgccggtgtcgaaagc
ctcgccatcgccacgccgccaagccgtgacaatgcgcagggttggccgaacaagacgatt
ctggccacctgtgccattctcggtgtggacgaggtctacgccgtcggtggtgcacaggcc
atcgcgatgttcgcctatggcgccaccgacctcgacaatccggtctccccggtgctgtgc
gagccggtggacaagatcactggtccgggcaacatcttcgtggccacggccaagcgtctc
gtttcgggcattgtgggcatcgacgcggtcgccggccccaccgagatcgccatcatcgcc
gacaagacctcgaacccggcatatgtcgccgccgacctcattggtcaggccgagcacgat
gaactcgccggatcggtgctcatcaccgacgacgatcagttggccgaggcggtgcaggcc
gagctcaacaagcgcgtaccgcgcaccgagcactccgaacgtgtggccaccagcctctcc
ggcaagcagtccggcatcattctcaccgacggcatcgagcagtcgatcgacgcggcgaac
gcctacgccgccgaacatcttgaagtgcagaccgcagacccggatgccgtgatcgcgaag
atccgcaacgcgggggccatcttccgcggcaactattccccggtgccgctgggcgactac
atgtcgggctcgaaccatgtgctgcccacctcgggcaccgcacgattcgccgccggtctc
ggtgtgcacacgttcatgaagccggtggaggtcatcgaatacgacgagcagggactgaag
gagctcgccgccagggtgaatgccctcgccgtctcggaagacctcccggcgcacggcgag
agcgtgctgacgcgcttcattgacgatccgtacaacaaggaaaccattaccgaacaggaa
gaagaagcaggattacgatga

DBGET integrated database retrieval system