KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00132Help
Entry
BIF_00132         CDS       T01840                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BIF_00132
Enzymes [BR:bbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BIF_00132
Exosome [BR:bbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BIF_00132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1771411..1773762
Genome map
AA seq 783 aa AA seqDB search
MPYRLDLQGFWAKKTLFYAEWLPNPVLHAYPLCMSNNHFNKDAIVAVDHAQLGTVSEGRF
YNPHEILGAHLGSGEYSDTATVRVLRPDAKEVVIVTPDSETKAEPELNGVYVAVVPAVKT
DRGYSVPDYRLRITKEDGSTVVENDPYRYLPTVGEMDLYLFGEGRHERLWEAMGANVKRY
EDSMGGNDGTHGEPVVGTAFTVWAPNAHSVRVVGDFNGWNGICHSMRELGSSGVWEIFIP
GVTAGEKYKYQILNVFNTWEMKADPMERSHEVPPKTASIVVESEYHWNDSDWMAKRAKTD
PHQGPVAIYEVNANSWRDDVHSYRELADKLVPYVAKLGFTHVEFMPLEEYPYLGSWGYQV
TGYYGVDSRLGSPDDFKYLVDKLHEAGIGVIMDWVPAHFPKDAFALGRFDGTPLYEDPDP
TRGEHPDWGTYIFNFGRREVRNFLVADACFWLDEYHMDGLRVDAVSSMLYLDYSRQPGQW
HPNKFGGRENLEAIDFIKEANATAYKNNPGIMMIAEESTAYPGVTAPTDQGGLGYGLKWN
MGWMHDTLEYLHEQPINRKWHHNEITFSMVYAYSEHYVLPISHDEVVYGKGSLFGKMPGD
DWQRYAGVRSLFAYQWAHPGKNLTFMGNELAQYGEWDYNSQLDWDCLNWPDHRGVQQLVA
DLNALYKKSPALWSQDFTPDGFQWLTSDDSDHNTLSFVRIGKNGEQMVVVVNFSGTAWQD
YQVALPQGGRWREVLTTDDRKYGGSDIHNTNIEANAGPYHSRDYSTKITVPALGVVFLEP
DNN
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgccctatcgcttggacttgcaagggttttgggcaaaaaagacgcttttttacgcagaa
tggctcccgaaccccgtgttgcatgcttatcctctatgtatgagtaacaatcatttcaat
aaagatgccatcgttgcagtggatcatgcccaactcggcaccgtgagcgagggtcgtttc
tacaaccctcacgagattctcggcgcccacctcggtagcggtgaatacagcgacaccgcc
accgtccgcgtacttcgccctgacgccaaggaagtcgtcatcgtcacccccgacagcgag
accaaggccgaaccggaactcaacggcgtctatgtcgccgtggttcccgccgtgaaaacc
gacagggggtattcggttcccgactaccgcctgcgcatcaccaaggaggacggctccacg
gtggtggagaacgacccgtatcgatacctgccgaccgtgggtgagatggatctctacctg
ttcggcgaaggacgccatgaacgcctatgggaggccatgggcgccaacgtcaagcgatat
gaggactccatgggtggcaatgatggcacccatggcgaacctgtggtcggcactgcattc
accgtctgggcgccgaatgcacattcggtgcgagtggtgggcgatttcaacggatggaac
ggcatctgccattcgatgcgcgaactcggctcctccggcgtctgggaaatctttatcccg
ggtgtgacggccggcgagaaatacaaatatcagattctcaacgtattcaacacttgggag
atgaaggccgacccaatggaacgctcgcacgaggtgccaccgaagacggcctcgattgtg
gtggagtccgaataccattggaacgattccgactggatggccaagcgcgcgaaaaccgac
ccgcaccagggtcccgtggcgatctacgaggtaaatgcgaacagttggcgtgacgacgta
cacagctaccgcgagcttgccgacaagctcgtgccgtacgtcgcgaagctgggcttcacc
cacgtggaattcatgccgttggaggaatacccgtacctcggcagctggggctatcaggtg
accggctattatggcgtggactcccgcctgggctcccccgacgacttcaagtatctcgtc
gacaagcttcacgaggcgggtatcggtgtaatcatggattgggtcccggcgcacttcccg
aaggacgccttcgcattgggccgtttcgatggaacgccattgtatgaggacccggatccg
acccgcggcgagcatccggattgggggacgtacatcttcaacttcggccgccgcgaggtg
cgcaacttcctggtggccgacgcctgcttctggcttgatgagtaccatatggacggcctg
cgcgtcgacgcggtctcctcgatgctctacctcgactacagccgtcaacccggtcaatgg
catccgaacaagttcggaggacgcgagaacctcgaggccatcgacttcatcaaggaggcc
aacgccacggcctacaagaacaatccgggcatcatgatgatcgccgaggaatccactgcc
tacccgggcgtcaccgccccgaccgaccagggcggtctgggttatggactcaaatggaac
atgggctggatgcacgatacgcttgaatacctgcacgagcagccgatcaaccgcaagtgg
caccacaacgagatcacgttctccatggtctacgcctattcggagcattatgtgctgccg
atcagccatgacgaggtggtgtacggcaaaggatcgctgttcggcaagatgccgggcgac
gattggcagcgctacgccggcgtgcgttccctgttcgcctatcaatgggcacatccgggc
aagaacctcaccttcatgggcaatgaactcgcacagtacggtgagtgggactacaacagc
cagcttgactgggactgcctgaactggcctgatcaccgtggcgtgcagcaactggtggcc
gacctcaacgctctgtacaagaagtctccagccctgtggagccaggacttcacccccgac
ggtttccagtggctcaccagtgacgattcggaccacaatacgttgagcttcgtgcgaatc
ggcaaaaacggcgagcagatggtcgtcgtggtcaacttctccggaacggcatggcaggac
taccaggtggcgctcccacaaggcggccgttggcgggaggtactcaccactgacgacagg
aagtacggcgggtccgacatccacaacaccaatatcgaagccaacgccggcccctaccat
tcgcgcgattattctacgaagataaccgtgccggccctcggtgtcgtattcttggaaccg
gataacaactga

DBGET integrated database retrieval system