KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00263Help
Entry
BIF_00263         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1441017..1441760
Genome map
AA seq 247 aa AA seqDB search
MRLWDTLGVMNDSISYRTLQRTDYPALTKMLCETWHKQDPQMDEDLQMKLAQIDLEYCLA
RTTTAEVAVRDGEVVGAVLGRIDAQETRKGINQHHRSVMKIMGPLFFNKSAHQALKNMLN
AEKADRQMIKQAKKDGHAYDGEIVLFIVREDMRGQGIGQHLFDWMLNEFKVNNVEHYFLY
TDTDCDYGFYEDRGMVRRMEMPMEPHTPKEDTEAHQEADYLDNHLHALMFDNETSPANEG
VNPLGRD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtgggatacacttggggttatgaatgattcgatcagttacaggacgttgcag
cgcaccgattacccagcgttaacgaagatgttgtgcgagacgtggcacaagcaggatccg
cagatggatgaggatctgcaaatgaagctcgcccagatagatctcgaatactgcctggca
cgcacaaccaccgcagaagtggctgtacgcgatggtgaggtggtcggcgccgttctgggt
cgcatcgacgcccaggagacccgcaagggaatcaaccagcatcatcgcagcgtcatgaag
atcatgggcccgcttttcttcaacaagtcagctcatcaggcgttgaagaacatgctcaac
gccgagaaagccgaccggcagatgatcaagcaggcgaagaaggacggccatgcctatgac
ggcgagatcgtgctcttcattgtgcgcgaggacatgcgcggccagggcataggccagcat
ctgttcgactggatgctcaatgagttcaaagtaaacaatgtggaacactacttcctgtac
accgacacggattgcgactacggtttctacgaggatcgcggcatggtgcgtcgcatggag
atgcccatggaaccccacacgccgaaggaggacaccgaggcgcatcaggaagctgattac
ctcgacaaccatttgcatgcgctgatgttcgacaacgagacgtcaccagccaatgagggt
gtcaatccgctcggccgtgactaa

DBGET integrated database retrieval system