KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00264Help
Entry
BIF_00264         CDS       T01840                                 

Definition
(GenBank) Hypothetical cytosolic protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1441777..1442145
Genome map
AA seq 122 aa AA seqDB search
MHMSEPEFERTVTEAVRSVPERFKKALSNIAITVADEPTDKEYVSMTHGDGELLGLYQGT
PITQRTTGYAGVLPDRITIFKGPHERICATHAQMVEQIRKTVLHELGHYFGFDDKYLHSH
GY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgagcgaacctgaattcgagcggaccgtcaccgaggcggtccgctccgttcca
gaacggtttaaaaaagcgctttccaacattgcaatcaccgtggccgacgagccgacggac
aaagaatacgtcagcatgacccacggagacggggagctgctcggcctctaccaaggcacg
ccgatcacccagcgtaccaccggatacgccggcgtgctgccggaccgcatcacgatcttc
aagggcccccatgaacgcatctgcgccacgcatgcgcagatggtcgaacagattcgcaag
accgtgctccacgagctggggcattatttcggattcgatgacaagtacctgcactcgcac
ggctactga

DBGET integrated database retrieval system