KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00269Help
Entry
BIF_00269         CDS       T01840                                 

Definition
(GenBank) Orotidine 5'-phosphate decarboxylase
  KO
K01591  orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00240  Pyrimidine metabolism
bbb01100  Metabolic pathways
Module
bbb_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BIF_00269
Enzymes [BR:bbb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     BIF_00269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase
Motif
Other DBs
NCBI-ProteinID: ADC85652
UniProt: D3R4H8
Position
1374434..1375405
Genome map
AA seq 323 aa AA seqDB search
MTQSLTDKEREAMHSDFGLRLSNSMKQYGPLCVGIDPHRGVLENWGYSVDAEGAELFAMR
MLQAASGRAAAVKFQLSMFERYGSRGFVALERALYAARQMELITIVDCLHGGLSTTISAI
ADAYFKPDAPMLADAITLLPYYGARSLGGVINDALDNGRGVFIASLTSNPEGASLQTAIR
QNGEYKGKTVAYGIAATAQKYNKSVKGLGSVGLIIGATISQWLQESGIEPGDFTGPILSP
GYGWQGAEGSDLKNVFHGTNGNVLVTVSRAISQSGPDMDALIESTQTIAADVRKALREAI
DGTSTAPRGHMANPKGLRTWEEQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatcgctcacagacaaggaacgcgaggccatgcactccgacttcggattgcgg
ctgagcaactcaatgaagcaatacgggccgctatgcgtgggcattgacccgcataggggc
gtgctcgagaactgggggtacagcgtcgacgccgaaggcgcggagctcttcgccatgcgt
atgcttcaggcggccagcggcagggccgcagccgtcaagttccagctctccatgttcgaa
cgctacggctcccgcggtttcgtggcgctggaacgcgccctgtacgcggcccgccagatg
gagctcatcaccattgtcgactgtctgcatggcggcttgtcgaccaccatctcggccatt
gccgacgcctatttcaagccagatgcgcccatgcttgccgatgcgatcacgttgttgcca
tactacggtgcgcggtcgctcggtggtgtgatcaacgatgcgcttgacaatgggagggga
gtcttcatcgcctcgctcacgtcgaacccggagggcgcgagtctgcagaccgcaatccgc
cagaatggcgagtacaaaggcaagacggtggcctatggcatcgccgcgaccgctcagaag
tacaataaatcagtgaagggcctcggttcggtcggactcatcattggcgcgaccatcagc
caatggctgcaggaaagcggcatcgaaccgggcgatttcacggggccgatcctctcgccg
ggctacggttggcaaggtgcggagggcagcgatctgaagaacgtgttccatggcaccaac
ggcaatgtgttggtgacggtgtcccgcgcgatttcgcaaagcgggcccgacatggacgcg
ctcatcgaaagcacccagaccattgccgccgatgtacgcaaggcattgcgcgaagccatc
gacggcacgtcgacggcgccacgcggacacatggcgaatccgaaaggattgcgcacttgg
gaggaacaatga

DBGET integrated database retrieval system