KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00286Help
Entry
BIF_00286         CDS       T01840                                 

Definition
(GenBank) DNA primase
  KO
K02316  
DNA primase [EC:2.7.7.-]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
DNA replication
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BIF_00286
Enzymes [BR:bbb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     BIF_00286
DNA replication proteins [BR:bbb03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BIF_00286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1325085..1327178
Genome map
AA seq 697 aa AA seqDB search
MLCHMAGMIKKEDIERVRNAADLYDIVSATVALKPSGVGAYVGLCPFHDERTPSFNVRPS
VGSWHCFGCGRGGDVFRFVQEQENIDFREAVELLADKYHIELHYENAGGANDSHRGTKRA
RLLEANEEAQKFFVSQILTEEALPARKLLAGRNFSQQDCARFGCGYAPQGWDNLVRHLAD
KGFTQQEMLDAGLARQGARGIYDYFRGRATWPIRDSTGRTLGFGARKLYDDDSIAAKYIN
TPDTQLYHKNQVLYGIDLAKPQIVKKRQVVIVEGYTDVMAMHLAGVDTAVATCGTAFGEE
HAKIVRRLISDDSLGGVQLTGPLRVEGEPLSSRIVFTFDGDAAGQKAALHAFGLDSSFQT
QTFVAVADNNLDPCDLRIERGDDALRALVVNARPLYDFVIDVAIGKFDTQYGTGQMGAVK
AVAPLIARIKDKSLLDLYTRKAARRIGIDLTILQREVQSARRAQHVPNEDAYASRQRGYD
RNYEREREQPPMNEARMREIERGNARSQHFHRIDDNVFITEMQFMATLVQIPRAVNAELF
KALTVHCFSTPVFQTMFEAVEAAGGLPEPGTSPGQWLHALTKAGGPLLAPVITELAVMNL
PLPQNMANGNAAQTGQQEPGSQSAQPMPEASAEQRQYANQLTASLIDTGYMRRIGILRQQ
ASRATNTHDQIRLFGAITEVERERKDLQSQIFGSAAG
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgctatgccacatggccgggatgattaagaaggaagacattgagcgcgtacgcaacgcg
gcggatctgtacgacatcgtctccgccacggtggcgctcaagccctcgggtgtgggcgcc
tatgtgggcctgtgcccgttccacgacgagcgcacgccgagcttcaacgtccgtccgtcg
gtcggctcatggcattgcttcggctgcggtcgtggcggtgatgtgttcaggttcgtgcag
gagcaggagaacatagacttccgcgaggcggtggaactgcttgccgacaagtaccatatc
gagctgcattacgagaacgccggcggtgcgaacgactcgcataggggcaccaagcgcgca
cgtcttcttgaggcgaacgaggaggcccagaagttcttcgtgagccagattctcaccgag
gaggcgctgcccgcccgcaagctgctcgccggccgcaatttctcgcagcaggactgcgcg
cggttcggctgtgggtatgcgccgcagggctgggacaacctggtgcgtcatctggccgac
aagggcttcacccagcaggagatgctcgacgccgggctcgcgcgccaaggagcccggggc
atatacgattacttccgcggacgagccacatggcccattcgcgactcgacgggccgtacc
ctcgggttcggcgcccgcaagctctacgacgacgattcgatcgccgcgaaatacatcaac
acgcccgacacccagctctaccacaagaaccaggtgctctacggcatcgacctggccaag
ccgcagatcgtgaagaaacgtcaggtcgtgatcgtcgaagggtacaccgatgtgatggcg
atgcatctggcaggcgtggacaccgccgtggccacctgcggcaccgccttcggcgaggag
catgcgaagatcgtgcgccgtctcatctccgacgattcgcttggcggcgtgcagctcacc
ggtccgctcagggtggaaggcgaaccgctgagctcgcgcatcgtattcaccttcgacggc
gacgcggccggccaaaaggcagcattacacgccttcggccttgattcctcgttccagaca
cagaccttcgtggccgtggcagacaacaacctcgacccctgcgacctgcgcatcgagcgc
ggcgacgacgccttgcgcgccctcgtggtcaacgcccggccgttgtacgacttcgtgatc
gacgtagccataggcaagttcgacacccaatacggcaccggccagatgggtgccgtcaag
gcggtggcgcccctgatcgcgcgcatcaaagacaagagcctgctcgacctctacacgcgc
aaggccgcccgcaggatcggcatcgatctgacgatcctgcagcgtgaggtgcaatccgca
cgacgtgcgcagcatgtgccgaatgaggacgcctatgcgtcacgccaacgcggttacgac
cgcaactatgaacgcgaacgtgaacagcccccaatgaacgaggcgcgtatgcgtgaaatc
gagcgtggcaatgcgagatcccagcatttccaccgcatcgacgacaacgtgttcatcacc
gagatgcagttcatggccacgctggtgcagattccgcgcgccgtcaacgccgagctgttc
aaggccctcaccgtgcattgcttctccacgccggtgttccagacgatgttcgaggcggtg
gaggccgccggtggccttccggaacccggcacgtcgcccgggcagtggctccatgcgctc
accaaggcgggaggcccgctgctggcaccggtcatcaccgagctggccgtgatgaatctg
ccattgccccagaacatggcgaacggcaatgcggcccagacaggccaacaggagccgggc
agccagtccgcccagccgatgcccgaggcaagcgcggagcagaggcaatatgccaaccag
ctcaccgccagtctcatcgacacaggttacatgcgaagaatcggcatcctgcgccagcag
gcgagtcgtgcgacgaacacgcatgaccagatccggttgttcggcgcgatcaccgaggtc
gagcgcgagcgcaaggacctgcagtcgcagatcttcggctccgcggccggctga

DBGET integrated database retrieval system