KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00308Help
Entry
BIF_00308         CDS       T01840                                 

Definition
(GenBank) Multidrug resistance protein B
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1434205..1435707
Genome map
AA seq 500 aa AA seqDB search
MTTRPTQGGKKRIANPAANDDRISPKLIGSIVSVGSLAFIGILTETVMTVLFPELMVEFS
VNTATVQWITTIYLLSVGVTMPVSSYLKRRFTMKSVFVAAVALAVVGSFIMIVGTSFPVI
IVARVIQGVGSGIATPLMINIILEQSPRSKVGRLMGVGSLVITVAPAIGPTVGGAVASIW
PWRSIFVIVIPVIVLISLPIGLKCITQTKPTEAVSLNPLQFLAIIVGLAGMILSLNQGGV
AVSEGVSGEPWGRSAAIAIVSLAVGVAALVFFVWSSRRSFSPLIRLGWLKDKVVMLHLIP
YTLLPMVGIGFGYVITNLAQLSLGTSALVAGMLVLPGALIGAFFAPVGGMLYDKHGPTKP
ILGAFACCFGALVLFLGFSMYLTSVLMASFYFIFGVGYALGFSNIMTDAISGIHHEFTPD
GNAVFNTALQFGGAAGTTLFSTILAIAQAGHGAEGTPVYRHATAVGGTWTFAVMLAIVAV
SWIMLARAFALNKARMEQRA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgaccgacacagggcggaaagaagaggatcgcgaacccggcggcgaatgac
gatcgcatttccccgaagctcatcggctcgatcgtttcggtgggatccctggcattcata
ggaatcctgaccgaaaccgtgatgaccgtactgttccccgaacttatggtggagttctcg
gtgaacactgcgaccgtgcaatggatcaccacgatctatctgctatcggtgggtgtcacc
atgcccgtctcctcttatctcaagcgtcgtttcacaatgaaatccgtattcgtggcggct
gtggcgctcgctgttgtcggttcgttcatcatgatcgtgggcaccagctttcctgtcatc
atcgttgcccgcgtcattcaaggtgtgggttccggcatcgcgacgccgctgatgatcaac
atcattcttgagcagtctccccgctccaaggtgggtaggctcatgggcgtgggttcgctc
gtcatcaccgtcgcaccggccataggtcccaccgttggtggcgctgtggccagtatctgg
ccgtggcgttctattttcgtcatcgtcatccccgttattgtgctcatctcgttgcccata
ggactcaagtgcatcacgcagacgaagcccacggaggcggtgagtctgaatccgttgcaa
ttcctcgccatcatcgtaggactcgccggcatgattctctcgctgaaccaaggtggcgtg
gccgtaagtgagggcgtgtccggtgagccgtggggccggtcggccgccatcgccatcgtg
agtctcgctgtcggcgtggctgcccttgtgttcttcgtgtggtcgtctcgccgctcgttc
tcgccgctcatccgtctgggatggctcaaagacaaggtggtgatgctccacctcattccg
tacacgctgctgcccatggtgggaatcggcttcggctatgtcatcaccaaccttgcgcag
ctgagccttggcacgagtgcgctcgttgcgggcatgctcgtgctgccgggggccctcatc
ggcgcgttctttgcgccggttggcggcatgttgtacgacaagcacggtcccaccaagccc
attctgggggcattcgcctgctgctttggcgccttggtgctattcctaggcttctccatg
tatctgacgtccgtgctcatggcgtcgttctatttcatcttcggagtggggtacgccctc
ggcttctcgaatatcatgacggacgccatctccggcatccaccatgagttcacgccggat
gggaacgccgtgttcaacaccgcgctgcaattcggtggagcggccggcaccacgctgttc
tccacaatcctggccatcgcgcaggctggtcatggtgccgagggaacgcctgtatacagg
catgccactgcggttggcggcacatggactttcgccgtcatgctggctattgtcgcagtg
tcttggattatgctggctcgggcttttgccctgaacaaagcccgcatggagcagcgtgca
tga

DBGET integrated database retrieval system