KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00341Help
Entry
BIF_00341         CDS       T01840                                 

Definition
(GenBank) Phosphoribosylformylglycinamidine synthase
  KO
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BIF_00341
Enzymes [BR:bbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.3  phosphoribosylformylglycinamidine synthase
     BIF_00341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1352712..1356527)
Genome map
AA seq 1271 aa AA seqDB search
MEQALSCFPILFSTVQSQIIAKERGSTVVFRVHVEKKPGFDVEAQQLTNELRTILGIESL
NNVRIINRYDVEGISEELFGQTIPTVFSEPQVDNVSIELPDVSGDTVFAVESLPGQFDQR
ADSASECIQLISQGERPTVRSARVYVLDGQLGDDDLAAIKKYVINPVETREAGLETRETL
ATYAPTPQPVEVLDGFREMDDAQLAEFIADRGLAMDEADLRFVREYFQGEQRDPTITEIK
VIDTYWSDHCRHTTFGTELDSVEIDDAVVKAAFDKYMAMRHELGRDEKPVCLMDMGTIGA
KWLKKNGVLTGLDESEEINACTVKVKVDVNGESEDWLFLFKNETHNHPTEIEPFGGAATC
IGGCIRDPLSGRSYVYQAMRVTGAADPRVPISETLEGKLPQRKLVTTAAHGYSSYGNQIG
LATGQVNEIYHPGYVAKRMEIGAVVGATPASHVRRETPAPGDKIILLGGRTGRDGIGGAT
GSSKAHNVESLELDGAEVQKGNAPVERKLQRLFRRGDACRLIKRCNDFGAGGVSVAVGEI
ADGLHVDLNQVPKKYDGLDGTELAISESQERMAVDVAAEDVDEFLKYAAEENLEAVVIAT
VTEDPRMVMEWNGEPIVDLSREFLASNGAAKHQDAHVPQQGSYRAPFSSGSLSERMNEML
SDINIASNKGLSERFDSTIGAATVLMPFGGKEQLTPAEAMVAKFPVFGETTTASAMAWGF
NPFLMERNQYTGAYMSVVESLAKLVAAGFEHEKAYLTFQEYFEKLRDEPERWGKPLAAVL
GALMAQVDLGVGAIGGKDSMSGSFEDLDVPPTLVSFAVAVGDMNRATSPEFKHPGDRVVR
IAPRYLADGITPDKDALLEVFSTIENLVTDGDALAISTPAYGGTAEALFKMCVGNRIGVA
LDDSIAVDDLFAPAYGSFIVELAPSANMPTVSNLVEIGPIGETTADYVFHAAGETLDLAN
LQEVWENGIASVFPYRSGETDAEAEAVDAISFETMEPTVYKGAKIAKPRVIIPVFPGNNC
EYDTAAAFERAGAEAQTLIVNNLTPSAVAESTQALVDAIHNSQIIMIPGGFSGGDEPDGS
AKFITAFFRAPAVTEAVRDLLNNRDGLMLGICNGFQALIKLGLVPFGDIVPMTAECPTLT
FNTIGRHQSRLVRTRVASNLSPWLAKTEVGDMHTIAISHGEGRFVASDGMLDQLIANGQV
ATQYVDEHGVPSMDLSVNPNGSMLAIEGITSPDGRVFGKMGHSERTGDGLYRNVPGNIYQ
PIFEAGVEYFG
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggccctttcttgttttcctatattgttttcaacggtacaatcccagattatt
gctaaagaacgaggaagcacagtggtttttcgcgtccatgtagagaagaagcccggattc
gacgtcgaggcgcagcagctgacgaacgaattgcgcacgattctcggcattgaatctttg
aacaacgtccgcatcatcaaccggtatgacgtcgagggaatcagcgaggagctgttcggc
cagacgatccccaccgtattcagcgagccgcaggtggacaatgtgagcatcgaactgccg
gatgtctccggtgacacggtgtttgcggtggaatcgctgcccggccaattcgaccagcgc
gcggattccgcaagcgaatgcatccagctcatcagccagggcgaacgaccgaccgtgcgc
tcggcccgcgtgtatgtgctcgatggccagttgggcgacgacgacctcgccgcgatcaaa
aagtacgtgatcaatccggtggagacccgcgaagccgggctggagacccgagagacgctc
gccacctatgcccccaccccccagccggtcgaagtgctcgatggcttccgcgaaatggac
gatgcacagcttgccgagttcatcgccgatcggggcctggcaatggacgaggccgatctg
aggttcgtacgcgagtatttccagggtgagcaacgagatcccaccatcaccgagatcaag
gtgatcgacacgtattggtccgaccactgccgccacaccactttcggcaccgagctcgac
tccgttgaaatcgacgacgccgtggtgaaggccgccttcgacaagtacatggcgatgcgc
catgagctcggccgcgacgagaaacccgtgtgcctcatggacatgggcacgatcggtgcg
aagtggctcaagaagaacggcgtgctcaccggcctcgacgaatcggaggagatcaatgcc
tgcaccgtcaaggtgaaggtcgatgtgaatggcgagagcgaagactggctcttcctgttc
aagaacgagacccataaccaccccaccgagatcgagcccttcggtggcgcggcaacctgc
atcggcggctgcattcgcgacccgctttcgggacgctcctacgtgtatcaggcgatgcgc
gtgaccggtgccgcggacccccgcgtgccgatcagcgagacgctggaaggcaagctgccc
cagcgcaagctcgtcaccaccgcggcgcacggctactcctcgtacggcaaccagatcggc
ttggccaccggtcaggtcaatgagatctaccacccgggctatgtggccaagcgtatggag
atcggcgccgttgtgggcgccacgccggcaagccatgtacgtcgcgagaccccggccccc
ggcgacaagatcattctgcttggcggccgtaccggccgtgatggcattggcggcgccacc
ggttcgtccaaggcacacaacgttgagtcgcttgaactcgatggagccgaggtgcagaag
ggcaacgccccagtggagcgcaagctgcagcgtctgttccgccgcggtgatgcctgccgc
ttgatcaagcgatgcaacgatttcggcgcgggtggcgtgtccgttgccgtcggagagata
gccgacggcctgcacgttgacctcaatcaggtacccaagaaatacgacggcctcgacggc
accgagcttgccatctccgagtcgcaggagcgcatggcggtcgatgtggctgcggaagac
gtcgacgagttcctgaagtatgccgccgaggagaacctcgaagccgtggtcattgcgacc
gtgaccgaagaccctcgcatggtgatggaatggaacggcgagccgatcgtcgatctctcg
cgtgagttcctcgcttcgaacggcgccgccaagcatcaggatgcccacgtgccccagcag
ggctcctaccgtgccccattctcgtccggctcactcagtgagcgtatgaacgagatgctc
tccgacatcaacatcgcctccaacaagggcctgtcggaacgcttcgactccacgatcgga
gccgccaccgtgctcatgccgttcggcggcaaggaacagctgacgccggcggaagccatg
gtggccaagttcccggtgttcggcgagaccaccaccgcctcggccatggcgtggggcttc
aaccccttcctcatggaacgcaaccagtacacgggcgcctacatgtcggtggtcgaatcg
cttgcgaaactcgtggcggcgggcttcgaacacgaaaaggcatacctcaccttccaggag
tatttcgagaagctgcgcgacgagccagagcgctggggcaaaccgcttgcggccgtgctc
ggcgccctcatggcgcaggtggacctcggggtcggcgccattggaggcaaggattccatg
tccggctccttcgaagacctcgatgtgcctcccaccctcgtctccttcgccgtggcggtc
ggcgacatgaaccgtgccacgtcgccggagttcaagcaccccggcgaccgtgtggtccgc
atcgcgccacgctatctggcggacggtatcacaccggacaaggacgcactgctcgaggtg
ttctccaccatcgagaacctggtgaccgacggcgatgcgctggccatctccaccccggct
tacggcggcaccgcagaagcgttgttcaagatgtgcgtgggcaaccgcatcggcgtggcg
ctcgacgactccatcgccgtcgacgatctgttcgcaccggcgtatggctcgttcatcgtc
gagctcgcgccatccgcgaacatgccgacagtctccaatctggtcgagatcgggccgatc
ggcgagaccaccgcggactacgtgttccacgcagccggcgagacgctcgacctcgcgaat
ctgcaggaggtgtgggagaacggcattgcatcggtgttcccctaccgcagcggtgaaacc
gatgccgaagccgaggcggtcgacgcgatctcgttcgagacgatggaaccgaccgtgtac
aagggtgcgaaaatcgccaagccgcgcgtgatcatcccggtgttccccggcaacaactgc
gaatacgacaccgcggcagcgttcgaacgcgccggggccgaggcgcagacgctcattgta
aacaatctgacgccctcagctgtcgccgagtccacgcaggcgctcgtcgacgccatccat
aacagccagatcatcatgatccccggcggtttctcaggcggcgacgaaccggatggctcc
gcgaagttcatcacggcgttcttccgtgcaccggcggtcaccgaggccgtgcgcgacctg
ctcaacaaccgtgacggtctcatgctcggcatctgcaacgggttccaggcgctcatcaag
ctcggtctcgtgcccttcggcgacattgtgcctatgaccgcggagtgcccgacgcttacg
ttcaacaccatcggacgccaccagagccgtcttgtacgcacacgcgtcgcgtcgaacctg
tcgccgtggcttgccaagacggaggtgggcgatatgcacaccatcgccatctcccatggc
gagggacgtttcgtcgcttccgacggcatgctcgaccagctcatcgcaaacgggcaggtt
gccacacagtacgttgacgaacatggcgtgccgagcatggacctgagtgtgaacccgaac
ggctccatgctcgccatcgagggcatcaccagcccggatggccgcgtgttcggcaagatg
ggccactccgagcgcaccggcgacggcctgtaccgcaatgtgcccggcaacatctaccag
ccgatcttcgaagccggcgtcgagtacttcggctga

DBGET integrated database retrieval system