KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00342Help
Entry
BIF_00342         CDS       T01840                                 

Definition
(GenBank) Phosphoribosylamidoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00230  Purine metabolism
bbb01100  Metabolic pathways
bbb01110  Biosynthesis of secondary metabolites
bbb01130  Biosynthesis of antibiotics
Module
bbb_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BIF_00342
Enzymes [BR:bbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     BIF_00342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-ProteinID: ADC85637
UniProt: D3R4G3
Position
complement(1356556..1357308)
Genome map
AA seq 250 aa AA seqDB search
MQKLDKLYEGKAKKLYATDDPDVLWVEYMNQATAGNGAKKAQIEGKGELNNQITSVIFDL
LKARGIDSHFVKRISDTEQLVRKMDMYPLEIIMRNTAAGSFAKRYGVEEGTALDKPILEF
CVKSDELGDPFINDDGIVALGIASEEELDEISRQARAVNDALKDIFSKIDVQLVDFKIEE
GKTGDGRILLADEITPDTCRLWDLKDGSGQIEHLDKDLFRRDLGNIIPAYEEIYDRLVKL
AEAEGVERAE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagctggacaagctctacgagggcaaggccaagaaactgtacgcaaccgatgac
cccgatgttctctgggtcgaatacatgaaccaggcaaccgccggcaacggcgccaagaag
gcacagatcgaaggcaagggcgaactcaacaaccagatcacctccgtcatcttcgacctg
ctcaaggcgcgcggcatcgactcccacttcgtcaagcgcatctccgacaccgagcagctc
gttcgcaaaatggacatgtacccgctcgagatcatcatgcgcaacacggcggccggttcc
ttcgccaagaggtacggtgtcgaggaaggcaccgcgctcgacaagccgatcctcgaattc
tgcgtgaaatccgacgagctcggtgatccgttcatcaacgacgacggcatcgtggcactc
ggcatcgcctccgaagaggagctcgacgagatctcccgccaggcacgtgcagtcaacgat
gcgttgaaagacatcttctcgaagatcgacgtgcagctcgtcgatttcaagatcgaggag
ggcaagaccggtgacgggcgaattctgctcgccgacgagatcaccccggacacctgccgt
ttgtgggacctgaaggacggctccggccagatcgagcatctcgacaaggatctgttccgc
cgcgatctgggcaacatcatccccgcctacgaggagatctacgaccggctggtcaagctc
gccgaagccgagggcgtcgagcgcgccgagtga

DBGET integrated database retrieval system