KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00368Help
Entry
BIF_00368         CDS       T01840                                 

Definition
(GenBank) Glycosyltransferase
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1358803..1360014
Genome map
AA seq 403 aa AA seqDB search
MSTMEAHNEAASPQSASDNATDRPLTIALVVDTFGNRGNGTSNSALQWAQELERQGHKVR
LVGINAPEYPARENHIPLVSWISAKQQMHFAQPSATLFDRAFDGVDVVHIYTPFKFGRHA
MAAARAKGLPVTAGFHVQPENVMYSAGPARWIPGMDRFIYWLFRRWLYSRVDAIHVPTNL
GKQLLLDHGYAKPIFVISNGYAPRFIPKEQRKGDAAPQIPVRIIASGRLSNEKNHVELIE
AICRCAHADDIHLTIAGTGPIRNKLVRFAKRKLKRPASIGFHKNSTMPQLLRSADLLVHP
SIADLESVSVIEGMASGLVPVIADSKLSAAGQFSLCPQSSYPVGDVDALAERIDWWIDHP
RELNTWGDTYARHTKDTYSVEESVRRFVEMERQIISDHTVSSR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcactatggaagcacacaacgaagcagcgtcgccgcagtcggcgtccgacaacgca
accgataggccactgacgatcgcactggttgtggacactttcggcaaccgcggcaacggc
acctcgaactcagcgctccaatgggcgcaggaactcgaacggcagggtcacaaggttcga
ttggtggggatcaatgcccccgaatatccggccagagagaaccacattccgttggtgagc
tggatttcggccaagcagcagatgcatttcgcccagccgagcgccacactgttcgaccgc
gccttcgatggtgtggacgtcgtgcacatctacacaccgttcaaattcggccggcatgcc
atggcggcggcccgtgccaagggcctgccggtcactgctggcttccatgtgcagccggag
aacgtcatgtattcggcagggccggcccgatggatccccggcatggatcggttcatctac
tggctgttcaggcgctggctgtattccagggtcgacgccatccatgtgcccacgaatctg
gggaagcaattgctgctcgaccacgggtatgccaaaccgatcttcgtcatctcgaacggc
tacgcaccgcggttcataccgaaggagcagcgcaagggcgatgccgcaccgcagattccc
gtgcgcatcatcgcttcgggtcgcctttcgaacgagaagaaccatgtcgagctcatcgag
gcgatctgccgttgtgcgcatgcggacgacattcatctgacgattgccggcacggggcca
atccggaacaaactcgtgcgtttcgccaagaggaagctcaagcgtcctgcctcgatcggc
ttccacaagaactcgacgatgccccagttgttgcggtcggcagacctgctcgtgcatcct
tcgatcgccgacctcgaatcggtgagcgtcatcgaaggcatggcctcgggcttggtgccg
gtgattgccgattcgaaactgagtgcggcaggccagttctcgctctgcccgcaatcctca
tacccagtgggcgatgtggacgcgttggccgaacgcatagactggtggatcgaccatccc
agggagctcaacacgtggggcgacacctatgcgcgtcatacgaaggacacgtattcggtg
gaggagtcggtgaggcgtttcgtcgagatggaacgccagatcatctccgaccacacggtt
tcctcacgctaa

DBGET integrated database retrieval system