KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00400Help
Entry
BIF_00400         CDS       T01840                                 

Definition
(GenBank) 60 kDa chaperonin GROEL
  KO
K04077  
chaperonin GroEL
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BIF_00400
Messenger RNA biogenesis [BR:bbb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     BIF_00400
Chaperones and folding catalysts [BR:bbb03110]
 Heat shock proteins
  HSP60 / Chaperonin
   BIF_00400
Mitochondrial biogenesis [BR:bbb03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    BIF_00400
Exosome [BR:bbb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BIF_00400
  Exosomal proteins of other body fluids (saliva and urine)
   BIF_00400
  Exosomal proteins of breast cancer cells
   BIF_00400
  Exosomal proteins of colorectal cancer cells
   BIF_00400
  Exosomal proteins of bladder cancer cells
   BIF_00400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1406665..1408278
Genome map
AA seq 537 aa AA seqDB search
MAKIIEYDEEARQGMLAGLDKLADTVKVTLGPKGRNVVLDKTYGAPTITNDGVSIAKEID
LEDPFERIGAELVKEVAKRTDDVAGDGTTTATVLAQSLVHEGLKNVVAGSNPIALRRGIE
KASDALVKQLVASAKPVETKEQIAATATISAGDPEVGEKIAEALDKVGQDGVVTVEDNNR
FGLDLDFTEGMRFDKGYISPYFVTNAEDQTAVLDDPYILLTSSKVSSQQDVVHIAELVMK
TGKPLLIVAEDVDGEALPTLILNNIRGTFKSCAVKAPGFGDRRKAMLQDMAILTGGQVVS
EDLGLKLDSIDLSVFGTAKKVIVSKDETTIVSGGGSKEDVAARVAQIRAEIEKTDSDYDR
EKLQERLAKLAGGVAVIKVGAATEVEAKERKHRIEDAVRNAKAAIEEGLVPGGGVALVQA
AEKVEKDFNLEGDEATGAAIVFSGIEAPIKQIAENAGLSGAVVIDKVRSLPEGEGFNAAT
DTYEDLMAAGVTDPVKVTRSALQNAASIAGLFLTTEAVVANKPEPAAAPAAGQDMGY
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcattgaatacgatgaggaagctcgtcagggtatgctcgccggtctggat
aagctggccgataccgtcaaggtgacgcttggtcccaagggccgcaacgtcgtgcttgac
aagacctatggcgcgccgaccatcaccaacgatggcgtttcgatcgccaaggagatcgat
cttgaggatccgttcgagcgcattggtgccgaactggtgaaggaagtggccaagcgcacc
gatgatgtcgccggcgatggcaccaccaccgcaactgtacttgcacagtccctcgtgcat
gagggtctgaagaacgtggtggccggatccaatccgattgccctgcgccgcggcatcgag
aaggcttccgacgctctcgtcaagcagcttgtcgcttccgcgaagccggtggagaccaag
gaacagattgctgcaaccgcaacgatttccgcaggtgaccccgaggtgggcgagaagatc
gccgaggctctcgacaaggtcggacaggatggcgtcgtcaccgtcgaagacaacaaccgc
ttcggcctcgatctcgatttcaccgagggcatgcgcttcgacaagggttatatttccccc
tacttcgtcaccaatgcggaagaccagacggccgtgctcgacgacccgtacattctgctc
acctcgagcaaggtctcctcgcagcaggatgtggtccacatcgccgaactggtgatgaag
accggcaagccgttgctgatcgtggccgaggatgtcgatggcgaggcactgcccacgctg
attctcaacaacatccgtggcaccttcaagtcctgcgccgtcaaggctccgggcttcggt
gaccgccgcaaggccatgctgcaggatatggcgattctgaccggcggtcaggtcgtctcg
gaggatctgggcctcaagctcgattccatcgacctgtccgtgttcggcaccgccaagaag
gtcattgtctccaaggatgagaccaccatcgtgtccggtggcggctccaaggaggacgtg
gccgcacgcgtcgcccagattcgcgccgagatcgagaagaccgattccgattacgatcgt
gagaagctgcaggagcgtttggctaagctggcaggtggcgtcgccgtcatcaaggtcggc
gcagccaccgaggtcgaggccaaggagcgcaagcaccgcattgaagatgccgtgcgcaac
gccaaggccgccatcgaagagggtctggttccgggcggcggcgtcgcactggtgcaggct
gccgaaaaggttgagaaggacttcaaccttgaaggcgacgaggccaccggtgccgcaatc
gtcttctcgggcatcgaggctccgattaagcagatcgccgaaaatgcaggtctctctggc
gccgtggtgatcgacaaggttcgttccctgcctgagggtgagggcttcaatgcggcaacc
gacacctatgaggatctcatggccgccggtgtgaccgatcctgtcaaggtgactcgttct
gctttgcagaatgcggcctccatcgcgggtctgttcctgacgaccgaagcggttgtcgcc
aacaagccggagccggcagcggcaccggccgccggccaggacatgggttactga

DBGET integrated database retrieval system