KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00485Help
Entry
BIF_00485         CDS       T01840                                 

Definition
hypothetical protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229534..1230433
Genome map
AA seq 299 aa AA seqDB search
MRTGKRRARNMTTVDCSGIDLGSNEDDMRVWTADVSWVIDDDQLVDAEDLAAHVAAIGQM
MLGVPVEQLAERIAAQLANQSVFRSVTVTVHMHWKAPLRTFEQLSATVTANRQSSANPSA
AAANTGGEESASTHDGALPVDPSYRDAVISLHSAALNAEQLFREVIVTLDSMPGNQVDGI
SPLYFVGSLNGTDGHAAVIKLSTAMGVRQLNQVLDALHTTHEGAVQLSVVATGKVGDESL
HAPKGAADHHLGAAVLEPWAAMDPNASYNGDPLAYLLAMAPDSAQVGVESERWVMGGGR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacagggaagaggagggcgaggaatatgacaaccgtggactgcagcggcatcgac
ctgggcagcaacgaggacgacatgcgtgtgtggacggcggacgtcagttgggtcatcgac
gacgaccagctggtggatgccgaggatctggccgcacatgtggcggccatcgggcagatg
atgctcggcgtgcccgtcgaacagcttgccgagcgcatcgcggcgcagctggcgaaccaa
tcggtgttccgctccgtcactgtcaccgtgcacatgcattggaaggccccattgcgcacc
ttcgaacagctcagtgcaacggtcaccgcaaaccggcaatcctcggccaacccatctgct
gccgctgcgaataccgggggcgaggaatctgcaagcacgcatgatggggcattgccggtc
gacccgtcataccgcgatgccgtcatttctttgcatagtgccgcgctgaatgccgagcag
ctgttccgtgaggtcatcgtcacactcgacagtatgccgggcaaccaagtggacggcatc
tccccactgtatttcgtgggctccctcaacgggaccgacggccatgccgccgtgattaaa
ctcagcaccgcaatgggagtgcgtcagctgaatcaggtgctcgatgcgctgcacaccaca
cacgagggagccgtgcagctgtcggttgtggccacaggcaaagtgggggatgaatcactg
catgcaccgaaaggtgcggcggatcatcatctcggcgctgccgtgcttgagccatgggct
gccatggatcccaatgccagctataacggagacccactggcgtatctgctggcaatggcg
cccgacagcgcacaggtgggcgtcgaatccgaacggtgggtcatgggaggcggccgatga

DBGET integrated database retrieval system