KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00491Help
Entry
BIF_00491         CDS       T01840                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bbb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1808811..1810418
Genome map
AA seq 535 aa AA seqDB search
MIAGCHARHRRMDRRKTFGHSTNEPLPDQGRWRKCLVSLLYLHVCLCISRSFPLTGVGSP
GAAGWGPDATLRQGVCALATSLLSGQCELYNDSSHRRNRGPMIQHNDKPQPNRNRRMVRI
VTTVIVTLAIVAIAIGAFAPVRHATDSDTTNGKAAPTSVPSRTSSPAPSTTISMPQTASP
SPTPKTDGTSDRAKRIVEAMSLDERAGQLVMAALQYGNDPATLQAMIQEQHVGNVILMGN
WVSGVENVARATQALQRLNASTGLPGLLIATDQEGGTVQHLSGPGFDAMPSATAQGQMPL
DRLRAAARDWALPLKRSGLAMNLAPSVDTVTIERAVNEPIGALYRDFGLDAQRNGEHAAA
FIEGMRAGGVGSAIKHYPGLGSVRGNTDFTANGIVDDTTTENGTEVNAFTSAIRQGKPAM
VMVSLATYKLIDPDNPAAFSPAIVTDMLRRGTPFDGVVISDSLSAGAVSSIAPQDLGVRF
IDAGGDICCMNAASYTQPILDGIRSRAAADKGFAAKVTASAERVVRLKIELGLVQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccgggtgccatgcccggcaccgaagaatggatcgaagaaagacattcggccat
tctaccaatgaacctctccccgaccaagggcgttggaggaagtgcttggtttctcttctg
tacctacacgtttgcctatgtatttccagatccttccccctgacaggcgtaggctctccg
ggtgccgccgggtggggcccggatgccacgcttcgtcaaggtgtctgcgcgcttgcgaca
tcgctcctcagcgggcagtgcgaactgtacaatgacagcagccatcgcagaaaccgagga
cccatgatccagcacaacgacaagccacagccgaaccggaacaggcgcatggtccggatt
gtcacgaccgtcatcgtgacattggcaatcgtcgccattgcgattggggcattcgcaccg
gttcgccatgctaccgattccgacacgacgaatggcaaagccgccccgacatcggttccc
agccgcacatcatcgccagcccccagcacgaccatttccatgccgcagacagcgtcgcct
tcgcccacccccaagacggatggcacctcggatcgggccaaacgcattgtagaggcgatg
agcctcgacgaacgcgccgggcaattggtgatggccgcattgcaatacggcaatgaccct
gccaccttgcaagcgatgattcaggagcagcatgtggggaacgtgatcctgatgggcaac
tgggtgagcggcgtcgagaacgtggcgcgtgccacacaggcactgcagaggttgaacgcc
tccaccggattgccaggattgctcatcgccaccgatcaggagggcggcacggtccagcat
ctttcgggaccgggattcgatgccatgcccagcgccacggctcagggtcagatgccactc
gaccggctgcgcgcagccgcgcgggattgggccctccccctcaaacggtccggtctcgcc
atgaatctggctccttcggtggacacggtgacgatcgaacgtgccgtcaatgaaccgatc
ggcgcgctctaccgtgatttcggactcgatgcccagcgcaatggcgagcatgctgcagct
ttcatcgaaggcatgcgcgccggcggtgtgggcagtgccatcaagcattacccgggattg
ggatcggtgaggggcaacaccgatttcacggcaaacggcattgtcgacgacacgacaacc
gagaacggcacggaggtgaatgcattcacctctgcgatccggcagggcaaacccgccatg
gtgatggtgtcgctggccacctacaaactcatcgaccccgacaatcctgcagccttctcc
cccgccatcgtcaccgacatgctgcgcagaggtaccccgttcgacggcgtggtgatctcg
gattccctctcggccggtgccgtgagctcgattgctccacaggatctgggcgtgcggttc
attgatgcgggaggggacatctgctgcatgaacgccgcaagctatacgcagccaattctg
gacggcatacgcagccgcgctgccgcggacaagggttttgccgccaaggtcactgcgagt
gccgaacgcgtggtgagactgaaaatagagctcggcttggtgcagtga

DBGET integrated database retrieval system