KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00563Help
Entry
BIF_00563         CDS       T01840                                 

Definition
RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BIF_00563
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BIF_00563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1584287..1584985)
Genome map
AA seq 232 aa AA seqDB search
MPPVEGESAEACKLPNICSNSAGGLMIGMLKGRVESVDTSNAVVDVHGVGFELRMPSNDL
TAMHMGQDVKIYTSMSVSQDAITLFGFLDARSKRMFLQLQKVSGVGPKVALSLLSTLAPD
DLAQAIHDGDDKALSRAPGLGRKGAQKIILELKGSIDVDKIETGEPTSTQRIPTDKGVEQ
VVEGLMSLGWKQADAQQAVDSVISSSGIALPLEEGNVPTVLRLALTSLDRGR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgccacccgtagaaggggagtccgcagaggcatgtaaactaccgaacatatgttcgaat
tcggcaggaggactaatgatcggaatgctcaagggccgggtcgagtcggtggacacttcc
aatgcggtggtggacgtccatggggttggattcgaattgcgtatgccttccaacgatctc
accgccatgcatatgggccaggacgtcaaaatatacacatccatgagcgtctcgcaggac
gccatcacgctgttcggattcctcgacgccagatcgaaacgcatgttcctccagctgcag
aaggtgagtggcgtcggaccgaaggtggcgctttcgcttctgagcacgctggcccccgac
gaccttgcacaggcaatccacgacggtgacgacaaggccttgtcacgcgcccccggtctg
ggccggaaaggtgcccagaaaatcatcctggagctcaagggctcgattgacgtcgacaaa
atcgaaacaggggagccaacttccacgcaacgcatcccaaccgacaagggggtcgaacag
gtggttgagggtctcatgtcgctgggctggaagcaggcggatgcacagcaggctgtggat
tcggtcatttcctccagtggcatcgcgttgccactggaggaaggcaatgtgccgactgtg
ctcagactggcattgacatcactggacagagggaggtaa

DBGET integrated database retrieval system