KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00731Help
Entry
BIF_00731         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
  KO
K07114  
Ca-activated chloride channel homolog
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
Transporters [BR:bbb02000]
 Other Transporters
  Pores ion channels [TC:1]
   BIF_00731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1399626..1400696)
Genome map
AA seq 356 aa AA seqDB search
MVDSRCGDSACGLVGYGVEVEAMSTFGFAPALGWIGGSLVAAVMVACAVTCVVLHARRGA
DGTDETLWSCVRRVLACVIVALMAFTPSMVTKTTSRAISTTDVVIVSDITPSMGVQDARY
GSKSDLSRLEAAKSAIADIVRDYPNSSFSAVSVGASGAVDVPLTPDTRAITNWAQSLDTE
DSSSSSGSSLDVVIDPLLRALKSIRDAHPDDRIVLYIITDGEQTVRNTRRTFSSLRHYID
DACVIGVGSTTGGRIPSKTAGQWVTDPSTGQPGVSIMDEGQIRSLADELSGKVVITSAND
TVASAQIAQQAGSWREDDTQKERTRINPIVWPLAIALAALLAWELGTWIATSRRLL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtggactctcgctgtggcgattctgcttgcgggctggttggttatggcgtggaggtt
gaagcgatgagtacgttcggctttgcaccggccctcggctggattggcggctcccttgtg
gctgcggtgatggtggcatgcgcggtgacgtgtgtcgtgctgcatgcacgtcgcggcgcc
gatggtaccgatgagacactctggtcgtgcgtaaggcgtgtgctggcatgcgtcatcgtg
gcgctcatggccttcacaccaagcatggtgaccaagaccaccagccgtgccatcagtacc
actgatgtggtcattgtctcggacatcacgccgtcgatgggtgtgcaggatgcccgctat
ggctccaagtccgacctttcccgcctcgaagcggcgaagtccgccattgcagacatcgtc
agggattacccgaattcgagtttctccgcagtatccgttggagcatcgggagcggtggat
gtgccgctgacgcccgacacccgtgccatcacgaattgggcgcagtcccttgataccgag
gattcctcgagttccagcggttcatcgcttgatgtggtgatcgatccgttgctgcgtgca
ctcaaatcgattcgcgacgcccacccggacgatcgcattgtgttgtacatcatcacggat
ggggaacagactgtgcggaacacacgccgcacattttcgtcgctgcgccactatattgac
gatgcctgcgtgatcggcgtcggctccaccaccggtggccggataccttcgaagaccgca
ggtcaatgggtcaccgatccctctacgggccagcccggcgtatcgatcatggatgaagga
cagattcggtcgctggccgacgagctcagtggcaaagtggtgatcacctcggcgaacgac
acggtggcgagcgcacagatcgcgcaacaggccgggagctggcgtgaagacgacacgcag
aaggagcgtacgcgcatcaatccgattgtctggccactggccattgcattggctgcgttg
ctggcatgggagctgggcacatggatcgccacttcgaggaggcttctatga

DBGET integrated database retrieval system