KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00779Help
Entry
BIF_00779         CDS       T01840                                 

Definition
(GenBank) GluA
  KO
K10008  
glutamate transport system ATP-binding protein [EC:3.6.3.-]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
ABC transporters
Module
Glutamate transport system
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BIF_00779
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     BIF_00779
Transporters [BR:bbb02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate transporter [MD:M00233] [OT]
    BIF_00779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1425461..1426246
Genome map
AA seq 261 aa AA seqDB search
MSENNTVEQLSPSGENAHHLVELEHVEKYYGNLHVLRDINLKVDKGEVLVIVGPSGSGKS
TMCRTINRLETIDSGVIRIDGQALPQEGKGLAQLRAEVGMVFQSFNLFANKTILENVTLA
PIKVRHMDRDQAEKEAMDLLARVGVDSQAMKMPSQLSGGQQQRVAIARSLAMHPKVMLFD
EPTSALDPEMVNEVLDVMVELAQEGMTMLCVTHEMGFARKAANKIVFMADGQILERGTPD
EFFEHPQTERAQEFLSKILTH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacaacactgtggaacaattgtcgccgagcggcgagaacgcccatcatctc
gtggaactcgagcatgtggagaagtactacggtaatctgcatgtgctgcgcgacatcaat
ctgaaagtagacaagggcgaggtgctcgtgattgtcggaccgtcgggctcgggcaagtcg
acgatgtgccgcaccatcaaccgattggagaccatagactccggtgtcatccgcatagac
ggccaggcattgccccaggagggcaagggtctggcccagttgcgcgccgaagtgggcatg
gtgtttcagtcgttcaatctgttcgcgaacaagacgatcctggagaacgtcacgcttgcg
ccgatcaaggtgcgtcacatggaccgcgatcaggccgagaaggaggccatggacctgctt
gcgcgagtcggcgtcgattcgcaggccatgaagatgccgtcgcagctatcgggtggacaa
cagcagcgcgtggccatcgcgcgctcgctggccatgcatccgaaggtcatgctgttcgac
gagccgacctcggcgctcgaccctgagatggtcaacgaagtgctcgacgtcatggtcgaa
ctcgcccaggaaggcatgacgatgctgtgtgtcacacacgagatgggttttgcgcgcaag
gcggccaataagatcgtgttcatggccgacggccagattctcgaacgtggcacgcccgac
gagttcttcgagcacccccagacggagcgtgcccaggagttcctgtcgaagattctcacg
cactga

DBGET integrated database retrieval system