KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00799Help
Entry
BIF_00799         CDS       T01840                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bbb00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1211322..1213409)
Genome map
AA seq 695 aa AA seqDB search
MSASTQHRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFS
WANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVI
WPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQA
FREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCS
DALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWH
IDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAIC
YFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIV
QDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVY
LFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGT
LFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGG
VAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNT
VTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatccacacaacatcgtgcgcaccgttggccacagcccctgccaggcaacgac
cggaaaatctggttcggtgcggactacaaccccgaccaatggcccgaagacgtacaggac
gaagacattcgcctgatgaagcaggctggcgttaacatcgtatccctggccatcttcagc
tgggcgaacatcgagacgagtgacggcaatttcgaattcgattggcttgatcgcgtcatc
gacaagctctacaaggccggcatagccgttgacctcgcatccgccaccgcttcgccgccc
atgtggctcacgagcgcacatcccgaggtactgcggcgcgacgagcaaggccatgtcata
tggcccggagcccgtcaacactggcgtcccaccagtccgacattccgcacatacgccctg
cgcctatgccgcgaaatggccgaacattacaaagacaacccggccattgtgtcatggcac
gtaggcaacgaatacggctgccataactacttcgactactcggatgacgccgtgcaggcc
ttccgggagtggtgccgcgaccggtacggcacaatcgacaaggtgaacgccgcgtgggga
acgaacttctggtcccaacgactcaactccttcgaggagatcctgccgccgcgttatgtg
ggcggcgaaggcaacttcaccaacccggggcgcctgctcgatttcaagcacttctgctcg
gacgcgctcaaggagttcttctgcgccgaacgcgacgtgctgtccgaagtgacgccgaat
attccgctcaccaccaatttcatggtgagcgcgtcgcagaacacgctcgactacgatgac
tgggcccacgaggtggacttcgtgtccaatgatcactatttcacccccggcagctggcat
atcgacgaactggcatactccgcctccctggtggacggcatctcaaggaagaagccctgg
ttcctcatggagcaatccacctccgcagtcaattggcgcgagatcaacccccgcaaggag
ccaggtgagctcatccgcgactcgatgctgcatctggcaatgggcgcggacgcaatctgc
tacttccagtggcgccagtcgcggtccggtgccgaaaagttccactcggccatgctgcca
ctggcaggggagcattcgcagatctaccgggatgtatgcgcattgggcgcagacctcgac
acattgagcgatgccggcatactgcgctcgaagctttcaaaggcacgggtggccattgtg
caagacatccagtccgaatgggccaccgagcatacggccacacccacccaacacatacgc
gaatggacggagcccctcgactggttcgccgccttcgccaatcgcggcgtgaccgcggac
gtgacacccatccacgcacaatgggatacgtatgacgccgtggtgattccctgcgtgtac
ctgttcagtgaggagatggccgaacgtctacgcacctttgtcaggaatggaggcaaggca
ttcgtcacgtactacagcgcactggccgatgagcacgaccgactgcacacggaaggctgg
cccgggttgatcggcgacgtcgtcggcgttcgcatcgaggaacattgcccactcggcacg
ctcttcccgggaatgctcgaccacctcgacgtcagcaacggcacagtcgtgcatgatctc
gccgacgtcatagacgcaatcgccgatgacaccaccgtgctcgccaccttcgaggcggat
ccggccacgggtatggacggtagggccgccatcaccgtgcacccctaccacgaaggcggc
gtggcctacattgccggcaagctgggcagggacggcatcagccagagcctgccggagata
tgtgcggcgctcggattcgagctcgatgcagacccgcgggccggcgatgtgctccgcgtg
gttcgggagcaggaggatggagccatcttcgaattcctgttcaaccgcacccgcaacact
gtcaccgcagaccgtcctgctggagacatgctcatatgcagcctggcaacggacagcacc
gacaaggtcaccctcgagccaaacggcgttctggcgttcaggcgctga

DBGET integrated database retrieval system