KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00802Help
Entry
BIF_00802         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGAP1 Abhydrolase_6 Abhydrolase_1 Abhydrolase_8 LIP Hydrolase_4 DUF2974 Esterase FSH1 Lipase_3 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: ADC85669
UniProt: D3R4J5
Position
complement(1397062..1398612)
Genome map
AA seq 516 aa AA seqDB search
MTKMVRSSIHGGAQYATATLDLVHGICSRLGACAADLKAQAIALSNARMRVAVLRTSTLQ
WCPEQNGMAALRAPVCESSGFGRSLHVHVEYLRLTDHAESARSQLHALAVQCERIADVLA
RAYGLYSEAEAKSRMATNRALQWAARVAPATMAKFTIAQALGGWLYGVVTEGNFSAAHAL
NAISWQQEGLMRAASAAIGLHDGQSPVPSGAYAIGGISSRATNLIQGDALTVESVDPHEP
SVAPVSDMGGALANLRRLSAANADSTHGEYATIAISRYVDADGRRSWLVTIPGTDGNFDS
PLGWEQNVELMSANAMQRRNADSARMVVEAMRQAGIGRDERVALIGHSQGGIIAATLASD
YADEYRIEHIVTAGSPIANHPMGKGTWVTSIEMEDELVAALDGEVNPRSEQWLTIRGEVR
NVADGSPADANGAVDDGTAAMTAVDQSHQGKYELTHDLAYHTAAYENALSLGSEALANHD
SHFMATIHGDYMETTYWSGRMEHGKHDIEMDDTHTQ
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagatggtgagatcatccattcatggtggcgctcagtatgccactgccacgctc
gacctcgttcacggcatatgctcacggttgggggcctgcgccgccgatttgaaggcacag
gccatcgccttgtcgaacgccagaatgcgtgttgccgtgctgcgcacctcaactcttcaa
tggtgtccggaacagaacggcatggcggcattgcgagctcccgtctgtgaatcgagtgga
ttcggtcgttcccttcatgttcatgtcgagtaccttcgcctgacggaccacgctgaatcc
gccagatcacagctgcatgcgctggccgtccaatgcgagagaatcgccgatgtattggcg
cgtgcatacggcctgtattccgaggccgaggccaaaagccgcatggccactaatagggca
ctgcaatgggccgcacgggtggcacctgcgacaatggcgaaattcaccattgcacaggct
ctgggcggatggctatacggtgtggtcactgagggcaatttctcagcagcccatgccttg
aatgccatctcgtggcagcaggaggggctgatgcgtgcggccagcgcagccataggcctg
catgacggtcaatcaccggtgccgtcaggagcatatgccatcgggggaatctcatcgcga
gcaacgaatctgattcaaggtgatgcgctgaccgtcgaatccgtggatccccatgaacca
tccgtcgcccctgtgtcggacatgggcggtgcactggcgaatctgcgaaggctctcggca
gcgaacgcggacagcacgcatggtgaatatgcaaccatcgccatctcacggtatgtggat
gccgatggccggcgttcctggctggtgaccattccgggaaccgacggcaacttcgactcc
cccttgggatgggagcagaatgtggagctcatgagcgccaatgccatgcaacgacgtaac
gcagacagcgcacgtatggtcgtcgaagccatgcggcaggcgggtatcggccgcgatgag
cgcgtggcgttgatcggccattcgcagggcggcatcatcgcggcaacgctggccagcgat
tatgccgatgagtatcgcatcgaacatatcgtgaccgccggctcccccatcgccaaccat
ccgatgggcaaggggacatgggtgaccagcattgagatggaagacgaactggttgccgcg
ctggacggcgaggtgaatcctcggagcgagcagtggctcaccattcgaggtgaggtgcgc
aatgtggcggacgggtcacctgccgatgcgaatggcgccgtggatgacggcaccgctgcc
atgaccgccgtcgatcaatcccatcaggggaaatacgaactcacgcacgacctcgcctac
cataccgccgcctatgagaatgcgctgtcgctggggtccgaggcgcttgcgaaccatgac
agccatttcatggcgaccattcacggcgactatatggagaccacctactggagcggccgc
atggaacacggcaaacacgacatcgagatggatgacacgcacacgcagtga

DBGET integrated database retrieval system