KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00869Help
Entry
BIF_00869         CDS       T01840                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BIF_00869
Enzymes [BR:bbb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BIF_00869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544898..547120
Genome map
AA seq 740 aa AA seqDB search
MTHIRRNDMSQINSAPPRREESPERLARPLIQLAKGCGVATCYIDQLGTYVEIRDAVLIS
VLGALGVDASTPELVDINLNARRNEAHERLVAPTVVKFLGTPASTPLHTKHGEPHIGLTL
EDGSDATDALSLTFREHDGDVDVYDLAIGDNLEIGYHTLHVRDGETGSERDVDVTLLCAP
ASIPVPEALASHKRWGWMTQMYSVRSPESWGVGDYGDLRELLVDAAGSGADFMLINPVHA
SAPVSPIEPSPYSPMSRRFINTTYIRPQDIAEFAELDEQDAAAVRALHEQVAPMNTESSP
MDLDAAWKAKRAALQIIFRQPRSPERQASFEAFKEKAGADLDTWALWSVAFEVLGEPWEP
DSWFRMTAKSNPRIQALRTEHPDLYEFACWLQWIAEEQLDAAQRAARDAGMSLGLMQDMA
VGVHSYGADAWGNPERFAVGSVTVGCPPDFYNQQGQDWGQPPLNPNYLELTGYRMYREMV
HHMFEHAGAIRIDHILGLFRLWWIPAGQGAKGGAYVTYNYDAMIAVLSIEATRVNGIVIG
EDLGTVPDFVRNVLARHGLLGTTVEWFARVDDSPNAGDPYAMPQTYRTYSLSSVTTHDLP
PTAGYLMLEQVKLREELGLLTEPVEEFRESALAERQAMLDLLVQGGWMSQEAADDVPDNL
QTIVEAMHAMLTDAPSLLLQAALVDGVGEARAQNQPGTSTQYPNWRIPLADEHLKVVPTQ
EVFKSPRVQALAKIMNRINQ
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgacccatatcagaaggaacgacatgtctcagatcaattcagcacccccgcgccgtgag
gaaagccccgagcgactcgcacgaccgctcatccagctcgccaaggggtgcggtgtggcc
acctgctacatagaccagctcggcacctatgtggagattcgcgacgcagtgctcatctcg
gtgctcggcgcgctcggcgtcgacgcctccaccccggagctcgtcgacatcaatctcaac
gcgcgacgcaacgaggcgcacgaacgcctggtggcgcccaccgtcgtcaagttcctcggc
acccccgccagcacgccgctgcacaccaagcacggggagcctcacatcggactcacgctc
gaagacggcagcgacgcgaccgatgccctctcgctcaccttccgcgagcatgatggcgac
gtggacgtctacgacctcgcgatcggcgacaatctggagatcggctaccacacactgcat
gtgcgcgatggcgaaacgggcagcgagcgcgacgtcgacgtcacactgttgtgcgcgccg
gcatccattccggtacccgaggccctcgcctcgcacaagcgctggggatggatgacgcag
atgtattcggtgcgctcccccgaatcgtggggcgtgggcgactacggggacctgcgcgaa
ctgctggtggacgccgccggctcgggtgccgacttcatgctcatcaatccggtgcatgcg
agcgcgccggtgagcccgatcgaaccgtcgccgtattcgccgatgtcgcgccgcttcatc
aacaccacctacattcgcccgcaggacatcgccgaattcgccgagctcgacgagcaggac
gccgccgccgtacgcgcattgcacgagcaggtcgcgccaatgaacaccgaatcgtcgccg
atggatctcgacgccgcctggaaggcgaaacgcgccgccttgcaaatcatcttcaggcag
ccgcgctccccggaacgtcaggcgtcgttcgaggcgttcaaggagaaggccggcgccgac
ctcgacacctgggcactgtggagcgtcgcattcgaagtgctcggggagccatgggagccg
gactcctggttccgcatgaccgccaaaagcaatccgcgcatccaggcgctgcgaaccgag
catcccgatctgtatgagttcgcctgctggctgcagtggatcgccgaggagcagctcgac
gcggcccagcgtgccgcgcgcgacgctggcatgtcgctcgggctcatgcaggacatggcc
gtgggcgtgcactcctacggtgcggacgcatggggcaacccggaacgcttcgccgtcggc
tccgtcacggtgggctgcccgccggacttctacaatcaacagggtcaggattggggccag
cctccgctcaacccgaactatctcgagctcaccggctaccgcatgtaccgcgagatggtg
caccacatgttcgaacatgcgggcgccattcgcatcgaccacattctcggactgttccgg
ctgtggtggatcccggccggccagggcgccaagggcggcgcatacgtcacctacaactac
gatgcgatgatcgcggtgctcagcatcgaggccacgcgtgtaaacggcatcgtgatcggc
gaggatctcggcaccgtgcccgatttcgtgcgcaatgtgctcgcacgacacgggctgctc
ggcaccacggtggagtggttcgcccgcgtggacgactcccccaacgccggcgacccgtac
gcgatgccgcagacgtaccgcacatactcactttcgtcggtcaccacacacgatctgccg
ccgaccgccggctatctcatgctcgagcaggtcaaactgcgcgaggagctcggcctgctc
accgagccggtggaggagttccgcgaatccgcgctcgccgaacggcaggccatgctcgac
ctgctcgtgcagggcggctggatgagtcaggaggccgccgacgatgtgccggacaatctg
cagaccattgtcgaggcgatgcacgccatgctcaccgacgcgccttcgctgctgctgcag
gccgcgctcgtggacggcgtgggcgaggcgcgcgcgcagaaccagccggggacgtccacg
cagtacccaaactggcgtattccgctcgccgacgagcatctcaaggtggtgcccacgcag
gaggtgttcaagtcgccgcgcgtgcaggcgctggcgaagatcatgaaccgcattaatcag
tag

DBGET integrated database retrieval system