KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00879Help
Entry
BIF_00879         CDS       T01840                                 

Definition
(GenBank) Mrp protein
  KO
K03593  
ATP-binding protein involved in chromosome partitioning
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
Chromosome [BR:bbb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BIF_00879
Mitochondrial biogenesis [BR:bbb03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    BIF_00879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1460002..1461114)
Genome map
AA seq 370 aa AA seqDB search
MTDQTQIIETAVIERLSHVIDPELGRSVTDLGMICGVDVRPTGLDSFNVRVNVELTVPGC
PLSAEISRQIEAAVTSYAEAQLTAEIVVGAMDEEKLKSLVNDLKAARRENPFSKPGTKTR
IFAIASGKGGVGKSSISANLAATFAALGYDTAAIDADIYGFSLPRLFGVHDQPTNLNGML
MPVTAWGVKLMSIGMFAGSDRAILWRGPRLQRSLEQFLADVWWGEPDVLILDLAPGTGDM
AISVAQALPNAELVVVTTPQPSASDIAVRSGLVALQVPMRVRGVVENMSYFEHAGERIDI
FGTGGGARVSSQLTDALHYEVPLMAQLPLDPRIREIGESEGRPAVLNDDGTLRDDDFGRT
FGHLAKSLLA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcagacgcagattatcgaaaccgccgtcattgagcggctcagccacgtgatc
gaccctgagcttggccgctcggtcaccgatctgggtatgatctgcggcgtcgatgttcgc
cccacaggcctggattccttcaatgtgcgggtcaatgtggagctcaccgtgcctggctgc
ccgctgtctgccgagatcagcaggcagatcgaggcggccgtgaccagttatgccgaggcg
cagctcaccgccgagatcgtcgtcggcgcgatggatgaggagaaactcaagtcgctggtg
aacgatctgaaagccgcccgtcgtgagaacccgttcagcaaaccgggtacgaaaacgcgc
atcttcgccatcgcctcaggcaagggtggcgtgggaaagtcttccatctccgccaatctt
gcggccacgttcgccgcactcggctacgacaccgcggccatcgacgccgatatctacggc
ttctcgctcccccgcctcttcggcgtccacgaccagcccacgaatctgaacgggatgctg
atgccggtgaccgcgtggggcgtcaaactcatgtcgattggcatgttcgccggttccgac
cgtgccattctatggcgaggcccccgtctgcagcgttcgctcgaacagtttctggccgat
gtgtggtggggcgaacccgatgtgctgattcttgatctcgcccccggcaccggcgacatg
gcgatttcggtggcgcaggcattgccgaacgccgagctcgttgtggtcacgaccccacag
ccctccgcgtcggacatcgccgtgcgttccggcctggtcgcacttcaggtgccgatgcgg
gtgcgtggcgtggtggagaacatgagctatttcgagcatgcaggcgaacggatcgacata
ttcggcacgggaggcggagctcgtgtgagttcccagttgaccgatgcgctgcactatgag
gtgccgctcatggcgcaattgccgctcgacccgcgtatccgtgagatcggcgaaagcgag
ggacgtccggccgtgctcaatgatgacggcacgctccgcgacgacgacttcggtcgtacc
ttcggacatctggccaagagtcttctggcatag

DBGET integrated database retrieval system