KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00886Help
Entry
BIF_00886         CDS       T01840                                 

Definition
(GenBank) Adenylosuccinate lyase
  KO
K01756  
adenylosuccinate lyase [EC:4.3.2.2]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Purine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BIF_00886
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BIF_00886
Enzymes [BR:bbb01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     BIF_00886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1395566..1397011)
Genome map
AA seq 481 aa AA seqDB search
MNLSEISPAIALTPLDGRYHAQTAALVEYLSEPALNRERMRVEVEWMILLANGFAGNDWK
PIVTGVKPLTEQEQAFLRSIPEEFGAQGIARHAAHEAVTHHDVKAVEYYIDDYLDSAEQV
LGAPTQLTDLKTLVHFACTSEDINNLSIARCVKNAIEHVWLPGADAIVDLLAQRAEEFKD
MPLLSLTHGQPATPTTLGKELAVYVYRLGRQLKHVREQEYLGKINGATGTFGAHLAALPN
VDWVAVSREFVENRMGLTWNPLTTQIESHDWQAELFDTISHTNRIMHNLCVDTWMYISRG
VFAQVPVKGATGSSTMPHKVNPIRFENAEANFEISCSLLDTLAATLVESRWQRDLTDSTT
QRNIGSALGYSVLAHNNLLGGLKSVHPNTQVMDRELDENWEVLGEPIQTAMRAQELAGRS
GMERPYEKVKELMRGHSISQADVESFIDSLDFDDETAARLKALTPATYVGLASMLVGYDR
P
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttccgagatctcaccagccatcgccctcacccctctggatgggcgctatcat
gcccagaccgccgctctggtggaatacctgagcgaaccggcactgaaccgcgaacgcatg
cgcgtggaagtcgaatggatgattctgctcgccaacggcttcgccggaaacgactggaag
ccgattgtcaccggcgtcaagccgctcaccgaacaggaacaggcattcctgcgttccatc
cccgaggagttcggggcacagggcattgccaggcatgccgcgcatgaagccgttacgcac
catgatgtgaaggctgtcgaatactacatcgacgactatctggatagcgcggagcaggtg
ctcggtgcccccacccagctcaccgacctgaaaactctcgtgcatttcgcctgcaccagc
gaggacatcaacaacctctccatcgcccgctgcgtgaagaatgcaatcgaacacgtatgg
ctaccgggcgcggatgccattgtcgacctgctggctcagcgtgccgaggagttcaaggac
atgccgttgctctccctcacgcacgggcagccggccacaccgaccacactcggcaaggag
ctcgccgtctacgtgtaccggcttgggcgccagctcaagcatgttcgtgagcaggaatac
ctgggcaagatcaatggcgccaccggcactttcggtgcgcatctggccgcattgccgaat
gtcgactgggtcgccgtctcacgtgaattcgtggagaaccgcatgggcctgacctggaac
ccgctcaccacccagatcgaatcgcatgactggcaggcggagctgttcgacacgatctcg
cacaccaatcgcatcatgcacaatctgtgtgtggacacatggatgtacatctcccgtggc
gtgttcgcccaggtaccggtgaagggcgcaaccggttcgtccacgatgccccacaaggtg
aacccgatccgtttcgagaacgcggaagccaacttcgaaatctcctgctcgctgctcgac
acgttggcagccacgcttgtggagtcccgttggcagcgcgatctgaccgactccaccacg
caacgcaacatcggctcagcattggggtattcggtgctggcgcacaacaacctgctcggt
ggcctcaagtcggttcatccgaacacacaggtgatggatcgcgagctcgatgagaactgg
gaggtgctgggcgagccaatccagaccgccatgcgcgcccaggagctggccggccgctcc
ggcatggaacgcccctacgagaaggtgaaggagctcatgcgcggccactccatctcgcag
gccgatgtcgagagcttcatcgattcgcttgacttcgacgacgagaccgcagcccgtctc
aaggctttgacgccggccacctatgtgggccttgcatcgatgctggtcggttacgatcgc
ccgtag

DBGET integrated database retrieval system