KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00934Help
Entry
BIF_00934         CDS       T01840                                 

Definition
(GenBank) Hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1412924..1414075
Genome map
AA seq 383 aa AA seqDB search
MPWPMTSMYRTDMATSEFDPIALARAEAIDTAHEPEDVGEFVTSEAHDDGVTDFRFEALM
KGYEGWQWSVTLYHDVELDHWTIDESSLIPTDKALLPPKWVPWKDRLLPSDLSVTDSIGT
PEDDERLDDGIGIDEAVSRTEELNAEQQAVETVQAQEGGSPDEQADALTAVEDVVEAVEE
LDLSRRHVLSELGQTQTAQRWYEGPHGPKSLSTKTADGNLCSTCGFFIPLAGSLKTMFGV
CANRWSPDDGKVVSVDHGCGEHSEIRPPEPSRMWVQTKPAYDDLHIDVVAQHGRDERKDE
ELLESLDEVDAESLAGLKQKALDMDDDMPDTSSFGIGSVSPQDFSGEEPEADSTVERSAA
KEVCEDEDAEQIASMCTSETVIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtggccgatgacttcgatgtacaggactgatatggcaacaagtgaattcgatccc
attgccttggcgagggcggaggcaatcgacaccgcgcatgaaccggaggatgtcggagag
ttcgtcaccagcgaggcccatgacgatggcgtgacggatttccgtttcgaggcgctcatg
aagggatatgagggctggcagtggtcggtcacgctgtaccacgatgtcgagctcgaccat
tggaccatcgacgaatcctcgctgatccctacggacaaggcccttctgccaccgaaatgg
gtgccttggaaggatcgtctgcttcccagtgacctctccgtgaccgattccatcggcact
ccggaggatgatgaacggcttgatgatggtatcggcattgacgaggcggtcagccgcaca
gaggaactcaatgccgagcagcaggctgtcgagaccgtgcaggctcaagagggaggatcc
cccgatgagcaagccgacgcgttgactgccgttgaagatgtggtggaagcagtggaggaa
ctcgacctgtcgaggcgtcacgtgctttcggaattggggcagacgcagacggcgcaacgc
tggtatgaaggtcctcatggccccaagtcgctctccacgaaaaccgccgatggcaatctg
tgctcgacctgtggtttcttcattccgctcgccggcagcctcaaaacaatgtttggtgtg
tgtgcaaaccgttggagcccggatgacgggaaagtggtctcggtggatcatgggtgcgga
gagcattccgagattcgtccgcctgagccaagtcgtatgtgggtgcagacaaagcccgcc
tatgacgatctgcatatcgatgtggtggcccagcatgggcgtgacgagcgcaaggacgag
gaattgctcgaaagcctggatgaggttgatgcggaatctttggcagggctcaaacagaag
gcactcgatatggacgacgacatgcccgataccagctcgttcggtatcgggtcagtgtcg
ccgcaggatttttccggtgaggaaccggaagcggattctactgtggagcgatccgctgcc
aaagaggtttgcgaggacgaggacgcagagcagattgcctcgatgtgcaccagtgagacg
gtgattgcctga

DBGET integrated database retrieval system