KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00948Help
Entry
BIF_00948         CDS       T01840                                 

Definition
(GenBank) Phosphoribosylformylglycinamidine cyclo-ligase
  KO
K01933  
phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.3.1]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BIF_00948
Enzymes [BR:bbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     BIF_00948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1338802..1339956)
Genome map
AA seq 384 aa AA seqDB search
MPPRNPPSISSPISSSQIFPIQIHTDSSIDLPISANRKVTMPQAYENAGVSVEAGYEVVK
RIKSHVARTNRPGVVSGIGGFGGLFDLASLGYNEPVLISGTDGVGTKLVIAKLMDKHDTI
GIDCVAMCVNDVVAQGAQPLFFLDYIACGKNDPAVLEQVVSGVADGCVQAGAALIGGETA
EMPGMYDEDEYDLAGFTVGCVERSKIVDGSTIEAGDVLIGLPSTGVHSNGFSLVRKALFE
QAGYTVHTRLPELDDRELGDVLLTPTKIYVKALMPLFEANLVRGVAHITGGGFIENVPRM
LPEGLAASIELGSWPVPPIFDVIEKAGDVDHMEMYNIFNMGLGMVVAIRPDRVDEAMNLL
EHAGEKAYRVGHVIEQVNERVDLA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaggaacccaccgagtatctcgtccccaatatctagttcccagattttcccg
atacagattcatacagattcatcaatcgacttgccgatttcggcgaacagaaaggtcaca
atgccacaagcatatgaaaacgcgggtgtgagcgtcgaagcgggctacgaggtggtcaag
cgcatcaaatcacacgtcgcacgcaccaaccgaccgggcgtggtgagcggcatcggcggc
ttcggaggcctcttcgacctcgcctcacttggctacaacgaaccggtgctcatctccggc
accgatggtgtgggcacgaagctcgtcatcgccaagctcatggacaagcatgacacgatc
ggcatcgactgcgtggccatgtgcgtcaacgacgtcgtggcgcagggagcccagccgctg
ttcttcctcgattacatcgcctgcggcaagaacgacccggcggtgctcgaacaggtcgtc
tccggcgtggccgacggctgcgtccaggcgggcgccgcgctcatcggcggcgagaccgcg
gagatgcccggcatgtacgacgaggatgagtacgatctggccggcttcaccgtcggctgc
gtggagcgatcgaagatcgtggacgggtcgacgattgaggcgggcgatgtgctcatcggg
cttccttcgaccggcgtgcattccaatggtttctcgctggtgcgcaaggcactgttcgag
caggccggctataccgtgcatacgcgtcttcccgagctggacgatcgggaactcggcgat
gtgctgctcacccccacgaagatctacgtgaaggcgctcatgccactgttcgaggccaat
ctcgttcgcggcgtcgcccacatcaccggcggcggcttcatcgagaacgtgcctcgcatg
ctgccggagggtctggccgcctccatcgagcttggctcgtggccggtgccgccgatcttc
gacgtgatcgaaaaagcgggcgatgtggatcatatggagatgtacaacatcttcaacatg
ggcctgggcatggtcgtggccattcgccccgaccgtgttgacgaggcgatgaaccttctc
gagcatgcaggtgagaaggcctatcgcgtcggccatgtgatcgaacaggtcaacgaacgc
gtcgacctggcctga

DBGET integrated database retrieval system