KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01077Help
Entry
BIF_01077         CDS       T01840                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase (EC:6.3.2.7)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bbb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bbb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47271..48821
Genome map
AA seq 516 aa AA seqDB search
MSLSLQSAARELFAENLLHEIITPHMWTMNAASVENNEVPFTAITYDTRTVTPGSLLVCK
GNFNPKYLEQANKLGMAAYVATNDYSAYTDAPGLIVSDDKKALSILAQAYYDHPERQLTL
IGITGTKGKTTTAYYTHAIINALSGNTTALFSSVDNCVDGMHYVESDLTTPESLDAVRMM
REAVNNGMKYLVMEVSSQAYKVNRVYDFHFDVAAFLNISPDHISPIEHPSFENYLWCKRQ
IIRNADMLVLGERSDHEQLLLEDAELNRVPVSTFALADSPAQSDIADVTCAPTNMEHTAF
DYFVDGERLGSLTLAMEGDFNYANAAAALAIAHDIGMDVSDPRALASLADVRISGRMEEM
HDSRSNTLAIVDYAHNFASVNALLDFVEQRYGAEHPHITLITGSAGNKAYDRREGIVKAA
QDRVQKLILTAEDTDTEPIEQICSEMANNVTNEDLDVQTILDRAEAVKHAVDEARAADGG
LSILLLIGKGDEQWIKDRNIHTPYEGDSQIIRRLFA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgtcgttgcaatccgcagcacgcgagctcttcgcggagaatctgctgcatgag
atcatcaccccgcacatgtggaccatgaacgcggcctccgtagagaacaacgaggtgccg
ttcacggcaatcacctacgacacgcgcacggtgacgccaggcagtctgctcgtatgcaaa
gggaacttcaatccgaaatacctcgagcaggcgaacaagctcggcatggcggcgtacgtg
gcgacgaacgattattcggcgtacacggacgcgcccgggctcatcgtctccgacgacaag
aaagcactcagcattctcgcccaggcatactacgaccacccggagcgtcagctcacactg
atcggcatcaccggcaccaagggcaagaccaccaccgcgtactacacgcacgccatcatc
aacgcgctgagtggaaacacgacggcattgttctcgtcggtggacaattgcgtggacggc
atgcactacgtggaatccgacctcacgacgcccgaatcgctcgacgcggtgcgcatgatg
cgcgaggcggtgaacaacggcatgaaatacctggtgatggaggtctcctcacaggcatac
aaagtcaaccgcgtctacgatttccatttcgacgtcgccgcgttcctcaacatctccccc
gatcacatcagccccatcgagcaccccagtttcgagaactacctgtggtgcaagcggcag
atcatacgcaatgccgacatgctcgtgctcggcgagcgcagcgaccacgagcaactgctg
ctcgaggatgccgaactgaaccgcgtacccgtctccacgttcgcattggccgattcgccg
gcgcagtccgacatcgcggacgtcacctgcgcaccgaccaatatggagcacacggcattc
gactacttcgtggacggcgagcgtctcggcagcctcacgctcgcaatggagggcgacttc
aactatgcgaacgcggccgccgctctggcaatcgcgcatgacatcggcatggatgtgagc
gacccgcgtgcgctcgcctcactcgccgacgtacgcatctcgggacgcatggaggagatg
cacgacagcaggtcgaacacgctcgccattgtcgactacgcgcacaatttcgcctcggtg
aacgcgttgctcgatttcgtggagcagcggtacggcgccgagcatccgcatatcacgctg
atcaccggttcggccggcaacaaggcatacgaccgtcgcgagggaatcgtcaaagccgca
caggaccgcgtgcagaagctcattctcactgcggaggacaccgacaccgagcccatcgag
caaatctgcagcgagatggccaacaacgtgacgaacgaggatctcgatgtgcagacgatc
ctcgaccgtgccgaagccgtgaagcatgccgtcgacgaggcgcgtgcggcggacggcgga
ctgagcatcctgctgctcataggcaagggcgacgagcagtggatcaaggaccgcaacatc
cacacgccatacgagggcgactcgcagatcatccgacgtctgttcgcttga

DBGET integrated database retrieval system