KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01102Help
Entry
BIF_01102         CDS       T01840                                 

Definition
(GenBank) hypothetical protein
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1453893..1457243
Genome map
AA seq 1116 aa AA seqDB search
MTCRLEHMTGTNSNTSDPQPRKPARWLRNLGVNAARYARQVESTAQSMFAGALPTHNMFT
PTPTNPLLGVKMPSAETIVLNPLMRRRSFSVAGTGLPFERVGWVQMPGLRRFALGYFTSH
DRFCTLAMADDTGAVYMTGDLYANLDAREPDLELDVTDSLTTDDDSRFGGTKPAHIATVE
GSARALVGDIRGRDGNGRMVWLARFLKSANRYTIENARAELPARLRTDLEYRDLMAVCFF
HLYLAVSVNGGLQGYGAGNIISNFRRFSPLAAIRTSVSQTDTARAHRMRVSGLEEYFADT
MRRIGVMGDLSELEADHGSEPLYMIESPVSHARFLVWEKRMPYDAMLTSLKLEGAVNRFL
LIDKWLDYNAAHSEQPIEDTVTFKQVARIDRRLLRNPSLSALPPTHPVHILDDPECFRVD
DYLHFGRGMSLSASLDASQAGVGVDVRHLVGSEWIYRHALANAVNALWLPFRFDTDFRSN
LQQGEVAFAFTSASRTLMPDELINMRSGAMAELDEAERSRISAEYNLQIGLIFASLAFGA
SEQIRRVSLRMDSLGLEEAVYERDNAIKTLMDSAMTQISDLTNLEDFTTHAGQGRFGERG
SALFSGSEETSGVGDDEHDGVQTQAMQTDADFDRELRDLLEHDESTSSDDTTTHHAESED
DTVQSILNVDEEFDRLRNSNPSIKHLLTVTFTRDEFIDYMHANSCADPFAVYDAFGAQYD
YDGTEGFRPVEPGFSMDDTRFTGDAAYTIPERRDRPLDATVARSLGAHNVRDLSISREEM
FRGTLELIADTAKNDGLRADRKATYAMGLIEQCADPELRNHATEITTAIIDGTPIPQITS
TVERALADARRKSQEMVFSGDEEGAIANMERVIGELDEMFESDGVVPRYFTSYTDRVVYN
RLFAMPDERIALVPDALFQAHLDMGEVLFRYDRGEEAMAHLNTLVRYAPATAGVHIQQAI
RLCVSEDWNSVRAAALNALRVACDPVDAANAYYYYVCASWMKGDTAVAVAAGNLATSLTQ
NLAPAQRARLERFRNLAMAQGEQIAQTGAQAVGVLMRHDVPVWPQVECAQIIRDAAFTAT
NEKIFPVAQALNVSWYALQGGNLGPGGMQFLRSLNA
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
ttgacgtgtagattggaacacatgacaggcacgaattcaaacacttccgacccacagcca
cgcaagccggcgcggtggctgaggaacctgggtgtcaatgcggccagatatgcgcgtcag
gtggagtcgacggcgcagagcatgttcgccggcgcattgcccacgcacaacatgttcacg
ccgactccgacgaatccgctacttggcgtcaagatgccgtcagcggagacgatcgtgctt
aatccgttgatgcgccgccggtcgttctcggtggctggaacgggactgccattcgagcgt
gtcggttgggtgcagatgcccggcctgcgcagattcgccctcggctatttcacctcgcat
gaccgtttctgcacgctggcgatggccgatgacaccggcgccgtgtatatgaccggcgac
ctgtatgcgaacctcgatgcacgcgaaccggatttagagcttgacgtcaccgattcactc
acgaccgatgacgattcccgcttcggcgggacgaaaccggcacacatcgccaccgtggaa
ggatccgcacgggcacttgtcggcgatatcagggggcgtgatggcaacggacgcatggtc
tggctcgctcgcttcctcaaatcggcgaatcggtatacgatcgaaaacgcccgtgccgaa
ttgcctgcgcgccttcgcacggatctcgaataccgcgatctcatggccgtgtgcttcttc
catctctaccttgcagtgtcggtcaatggcggcctgcaggggtatggggccggcaacatc
atttcgaatttccgtcgattctcaccgctcgcagccattcgcaccagcgtgtcacagacg
gacacggcacgtgcgcaccgcatgcgggtgagcggtctcgaggagtacttcgccgacacg
atgagacgcataggtgtcatgggtgacctgtccgaattggaggcagaccatggcagtgaa
ccgctgtatatgattgaatcgcccgtctcccatgcgcgtttcctcgtatgggagaagcgc
atgccatatgatgcgatgcttaccagcctcaagctcgagggggcggtcaaccggttcctg
ctgatcgacaagtggctcgattacaatgccgcccacagcgaacagccgatcgaagatacc
gtgacgttcaagcaggtcgcccgcatcgaccgtcgtctgttgcgcaacccgtcgctgtcc
gccctgccgccgacccatcctgtgcatattctcgacgaccccgaatgtttccgtgtagac
gattacctgcatttcggcaggggcatgtcgctgtccgcgtcgctcgacgcctcacaggcc
ggcgttggcgttgatgtacggcatctcgtcggcagcgaatggatataccggcacgccctt
gcaaatgcagtcaacgccctatggcttcctttcagattcgacacggatttccgttcgaac
ctgcaacaaggtgaggtggcattcgccttcacctcggcaagccgcacgctcatgcccgac
gagctcatcaacatgcgatccggcgccatggccgaactcgatgaggccgagcgttcacgg
atcagcgcggaatacaatctgcagatcgggctcatcttcgcctccctcgcattcggtgcc
agcgagcagatcagacgcgtctcgttgcgcatggattccctcgggctggaggaggccgtc
tacgaacgcgacaatgccatcaagacgctcatggacagcgcgatgacgcaaatctccgat
ctgacgaatcttgaggatttcaccacgcacgccggccagggaagattcggcgaacgcggc
agcgccctgttctccggctcggaagaaacctcgggagtcggcgacgatgagcatgatggg
gttcagacgcaggccatgcagaccgatgccgacttcgaccgcgaattgcgcgacctgctc
gagcacgacgaatccacgtcgtccgatgatacgacgacgcatcatgccgaatcggaggac
gacacggtgcaatccatcctgaacgtggatgaggaattcgaccgattgcgcaacagcaac
ccctccataaaacacctgctcaccgtcacattcacgcgtgatgaattcatcgactacatg
cacgccaacagctgtgccgacccgttcgccgtatacgacgcgttcggcgcgcaatacgat
tacgatggcaccgaaggattccgaccggtcgaaccaggcttcagcatggacgacacacgc
ttcaccggcgacgcggcctacacgattccggaacgacgcgacaggcctctcgatgcaaca
gtggcgcgatcactgggcgcacacaatgtacgcgacctgtcgatctcgcgagaggaaatg
ttccggggcaccctcgaactcattgcggacactgcgaagaacgacggcctacgtgccgac
cggaaggccacctatgcaatgggcctgatcgagcagtgcgcagatcccgaactgcgcaac
cacgccaccgagatcaccaccgcaatcatcgacggcacccccataccgcagatcaccagc
accgtggagagagcactcgccgacgcacgccgtaaatcacaggagatggtgttctccggt
gatgaggagggggcaatcgcgaacatggaacgcgtgatcggcgaactcgacgagatgttc
gaatcggacggcgtggtgccgcgctacttcacctcctacaccgaccgggtggtgtacaac
cggctgttcgccatgccggacgagcgcatcgccctcgtgcccgatgcgctgttccaagct
catctcgacatgggcgaagtactgttccgctatgacaggggcgaggaggcgatggcccac
ctcaataccttggtgagatacgcgcccgccaccgctggcgtacacatccaacaggccata
cgactatgcgtctctgaggattggaactcggtgcgagcagccgcactgaacgcgctgcgc
gtagcctgcgacccggtggatgccgccaacgcatactactactacgtctgcgccagctgg
atgaaaggcgacaccgccgtcgcagtggcggccggcaacctcgccacgtcgctcacccag
aacctcgcacccgcgcaacgtgccaggctcgaacgattccgcaacctcgccatggcacag
ggcgaacagatcgcacagaccggtgcccaggccgtcggagtcctgatgcgacatgacgtg
ccggtgtggccgcaggtggaatgcgcgcagattattcgcgacgctgccttcaccgccacc
aacgagaagatcttccccgtggcacaggcactcaacgtgagctggtatgcgctgcaggga
ggtaatctgggcccgggaggcatgcagttcctgcgctcgctgaatgcgtag

DBGET integrated database retrieval system