KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01116Help
Entry
BIF_01116         CDS       T01840                                 

Definition
(GenBank) 2,5-diketo-D-gluconic acid reductase A
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1444191..1445027)
Genome map
AA seq 278 aa AA seqDB search
MALQDGEHTIALNNEVLMPEIGFGVWHAEEGPETVNAVKAALANNYRLIDTAAFYKNEKS
VGEAIASSDVPRDQIFVTTKVWNDDIRAGKTKEAFDKSLKLLDLDYLDLYLLHWPVEGWQ
QAWKELETLYRDGRVKAIGVCNFEQDQLEELLDLAEIKPAVNQIESNPLFANQDLIDFCH
SKGIAVEAWHPMGGRGSDLFENETLRDIGDKYGKSPAQVMIRWHMQREVIPLPKSVHETR
IVQNIHVFDFELGENDMARINAMDTGERQGADPHHVDF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcaggatggcgaacataccatcgcactgaacaacgaggtactcatgcccgaa
atcggcttcggcgtatggcacgccgaagaaggcccagagacggtgaacgccgtcaaggcc
gcgctggccaacaactaccgtctcatcgacacggcggcgttctacaagaacgagaagtcg
gtgggagaggccatcgcctcgtccgacgtgccacgtgaccagatcttcgtcaccacgaag
gtgtggaacgacgacattcgcgccggcaagacgaaggaggccttcgacaagagcctcaag
ctcctcgatctcgattatctcgacctctacctgctgcactggccggtcgaaggctggcag
caggcatggaaggaactggagacgctctaccgcgacggccgcgtcaaggccattggcgta
tgcaacttcgagcaggatcagctcgaagagctgctggatctcgccgagatcaagcctgcc
gtcaaccagatcgagtccaacccgctcttcgccaatcaggatctcatcgacttctgccac
agcaagggcattgcggtcgaggcatggcatccgatgggaggtcggggcagtgatttgttc
gaaaacgagacgctgcgcgatatcggcgacaaatacggcaagtcccctgcccaggtgatg
attcgctggcacatgcagcgtgaggtgattccgctgccgaagtcggtgcatgaaacccgc
atcgtgcagaacatccacgtattcgacttcgaactgggcgagaacgacatggcccggatc
aacgcgatggacaccggcgaacgtcagggtgccgatccccatcacgtcgacttctga

DBGET integrated database retrieval system