KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01202Help
Entry
BIF_01202         CDS       T01840                                 

Definition
(GenBank) Cyclopropane-fatty-acyl-phospholipid synthase
  KO
K00574  
cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
Enzymes [BR:bbb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     BIF_01202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1379946..1381235
Genome map
AA seq 429 aa AA seqDB search
MNMAAMTVAQMIELFLKPGAPVHIESFDGSSYGSDDAPLTLQVKNSRAIYYMVNAPSELG
LARAYLQGDIDSPQLVPGNPYALFKELVPLKSYLRTPNPAQLAKALASVASHGFHRPAPP
DIEGPSRARRISEGLLPHSKAGDEATVSYHYDQSNEFYSMFLGPSMTYTCAVFDSPLMSL
EAAQKNKIDLVLDKLALQPGERLLDIGCGWGSMVIEAAKRGIKALGVTLSEEQVEWAQRW
IKDEGLEDLAEVRLMDYRDVPEGDFDGICSIGMMEHVGHKHYPSYFKEIYAKLKPGAKLL
NHQITRCNSHQGKKAGQFIDRYIFPDGELSSPAEIEMVIQDTGFEVINQENLRQHYALTL
HRWNENLVAHWDDAVKLVGEPKARLWGLYMAGCAFNFEMNNIQVHQFLAIKPNDEGTDTY
PLRPWWPNH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggccgcaatgaccgtggcacagatgatcgagctgttcctcaagccgggtgca
cctgtgcatattgaaagtttcgatgggtcgtcgtatgggtccgacgatgctccgctgacg
ttgcaggtgaagaactcgcgcgccatctactacatggtgaatgcgccgagcgagctcggc
ctggcccgcgcctacctgcagggggacatcgattcgccgcagctcgtgcccggcaatcca
tatgcgctgttcaaggaactcgtaccgctcaagtcgtacctgcgtacaccaaatccagcc
caactggccaaggcgctcgcttcggtggcctcccatgggttccaccgtcccgcgcctccc
gatatcgagggcccaagccgtgcccgccgcatcagcgaaggactgctgccgcattcgaag
gccggcgacgaggccacggtgagctaccattacgatcagtcgaacgaattctattcgatg
ttcctgggaccatccatgacctacacctgcgcggtgttcgactccccgctcatgtcgctc
gaggccgcgcagaagaacaagatcgacctcgtgctcgacaagctcgcactccagccggga
gaacgactgctcgacataggttgcggttgggggtccatggtgatcgaagctgccaagcgc
ggcatcaaggccctcggcgtcacgctgagcgaggagcaggtcgaatgggctcagcgctgg
atcaaagacgaaggactggaggacctcgccgaggtgcgactcatggactatcgtgacgtt
cccgaaggcgatttcgacggcatctgctccatcggcatgatggagcatgtcgggcacaag
cactacccgtcgtatttcaaggagatctacgccaagctcaagccgggcgccaaattgctc
aaccaccagatcacccggtgcaactcgcatcagggcaagaaagccggtcagttcatcgac
cgttacatattcccggacggcgagctctcctcaccggccgagatcgagatggtgatccaa
gacacgggcttcgaggtgatcaatcaggagaacctccgccagcactatgcactcacgctg
caccgttggaacgagaatctggtggcgcattgggatgacgccgtcaagctcgtcggtgag
ccgaaggcccgtttgtgggggctctatatggccggttgcgcgttcaatttcgagatgaac
aacattcaggtgcatcagttcctcgccatcaaaccaaacgatgagggcactgacacctac
ccgttgcgtccatggtggccgaaccactga

DBGET integrated database retrieval system