KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01342Help
Entry
BIF_01342         CDS       T01840                                 

Definition
(GenBank) Inositol monophosphatase family protein
  KO
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Streptomycin biosynthesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BIF_01342
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BIF_01342
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     BIF_01342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1389696..1390643
Genome map
AA seq 315 aa AA seqDB search
MLVLEQIFPRHKVTGGIGMQAGLRELAVQVSRIAEDAGKHALKDQLMPKDLVTLNTVQRD
YSRGLKVDDRLSQFIYNRLTYIDPFKGRWEDRTDEWAPGDRYWCVGGVDGVINYSRSMAE
WSVTISLFEFNEFGSAQPILGVIHAPALNLTYLAARQQGAIRMRKTPVGEKREKIMPSTV
SHLDGSIVSFGMSYVPQEAQHALNVVASLAGKPADIKRIGPVSLDVCKVADGTYDAYFEP
HLHERDVPAISAAAVVLWEAQGQLSTWEGGLIHWRSQNDLVATNGQIIQELQPYLINSDC
GESYHHHEQKPAGQQ
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgctagtcttggaacagatttttccgagacataaggtcacaggaggcattggtatgcag
gccggattacgggagctcgcagtgcaggtgagtcgcatcgccgaggacgccggcaagcat
gcgctcaaggaccagctcatgccgaaggatctggtgacgctgaacacggtgcagcgtgac
tactcacgcgggctcaaggtggacgaccgtctgtcgcagttcatctacaatcgtctcacc
tacatcgatccgttcaaaggccgttgggaggatcgcaccgacgaatgggcgcccggtgac
cggtactggtgcgtgggcggtgtcgatggcgtgatcaactattcgcgcagcatggccgaa
tggagcgtgaccatctcgctgttcgaattcaatgagttcggatcggcccagccgattctg
ggggtgattcatgcgccggcactgaacctcacctatttggccgcccggcagcagggcgcg
atccgcatgcgcaagacaccagtgggggagaagcgcgagaagatcatgccatccacagtc
agccacctcgatggctcaatcgtgagcttcggcatgtcgtatgtgccgcaggaggcacaa
catgccctcaatgtggtcgcgagcctcgccggcaagcccgccgacatcaaacggatcggg
cccgtctcgctcgatgtgtgcaaggtggccgatggcacctacgacgcgtacttcgaaccg
catctgcatgaacgtgatgtgccggccatctcggccgccgccgtggtgctctgggaggcc
caagggcagctgagcacatgggagggcgggctcatccactggcgtagccagaacgatctc
gtggccaccaacggacagatcatacaggagctgcaaccctacctcatcaactctgattgt
ggggaatcctaccatcatcacgaacagaagcccgcgggacaacagtga

DBGET integrated database retrieval system