KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01343Help
Entry
BIF_01343         CDS       T01840                                 

Definition
(GenBank) Hypothetical protein
  KO
K13570  
prokaryotic ubiquitin-like protein Pup
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Brite
Ubiquitin system [BR:bbb04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   BIF_01343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1390663..1390947
Genome map
AA seq 94 aa AA seqDB search
MNSPCGTGHIRHRYWNPHQIGGAMPSASGHHQIPAETQRHDDDQTQETAQGLSAAAMLAQ
EQADDLDAILDDIETVLETNAEEYVSSFVQKGGE
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
ttgaacagcccatgtggcacagggcacatccgacatcgatattggaatccacaccagatt
gggggagcaatgccatctgcatccggacaccatcagatccccgccgagacacagcggcat
gatgacgaccagacccaggaaacggcccagggtctttccgcagcggccatgcttgcgcag
gagcaggctgacgatctcgatgcgattctcgatgacatcgaaaccgttctcgagacgaac
gctgaggaatatgtgagcagcttcgtgcagaaaggcggcgagtga

DBGET integrated database retrieval system