KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01624Help
Entry
BIF_01624         CDS       T01840                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bbb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BIF_01624
  Lipid metabolism
   00561 Glycerolipid metabolism
    BIF_01624
   00600 Sphingolipid metabolism
    BIF_01624
Enzymes [BR:bbb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BIF_01624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(507067..509466)
Genome map
AA seq 799 aa AA seqDB search
MMLEHSRPALLDELTAPRNALKPDSKGRIVWGNGTVTLVFAVSDDRPVTLIGMSGRGMEP
VDANIAGEPDAQPIVELRSSLDGGGDNRLKLAVSSAGLKLRFVRAYELNRLGDERQPVTL
LAIVQRDPDGDGPLVTSVFEATAHTSAVRTYTRLCSEEPYPVEAVSSMNATLPMEAAKLE
DAQAQVYWGESSWDCENAWQSAPLRSTTLRDRNQVINPGMSSARFARRSTSTWSTGEFEP
MGIVEGGGRPGELGHFSFAWQIEHNGAWEWEIGEDDPGLRVSAYGPEYDDHQWFIMLRDN
QPFVTVPVSFVVCAGDWQHAVAEMTVQRRALYRAKAMEMGRLEQAEQAKGLVVYNDYMNT
LWGDPRIEKELPLVEGAAKVGADVFCIDAGWYDSEDGGWWDMVGEWKPSMNRFGDIRLAG
LIHDIQSHGMKAGLWLEPEVIGVRSPLAKMLPDSAFFCRHGVRIADQGRYHLDFRSPVAR
AHATATVDRLIDEFNVRFFKFDYNTTPGAGTDVDTDSVGEGLLEHCRAVQQWIEQIRAKH
PDVMIENCGSGAMRADYAMLSRLDMQSTSDQSDPLVYAAIAAGAGMTVLPEQQGNWGYAQ
QEMDDETAVFTLAAGILGRLYLSGFIDRMDEARLGLVRDAIALHRTILGGQSHLVPWWPC
GLPDFNSPWLVYGLRHAPNVTGLSHDEDWNGTDGQGSEHVDEAQYLTIWRRGGINSLYLE
IGEGAHIEQVFPNPAKPEHAPDAKPWRIEWADSETVRIEASADKEPSARVFAITFPQPSA
DGTADDDASENAGHDIEGR
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcttgaacatagccgccccgcattgttggacgagttgacggcgccccgcaacgcc
ttgaagccggattcgaaagggcgcatcgtatggggcaacggaacggtgacgctcgtcttc
gccgtgagcgacgacagaccggtgacattgatcggcatgagcggccggggcatggagccg
gtagatgcgaacatcgccggcgaaccggatgcgcagccgatcgtggaactgcgcagttcg
cttgacggcggcggggacaacagactgaagctcgccgtttcgtccgccggcctcaaactg
aggttcgtgcgggcatatgagctcaacagattgggcgatgagcgacagccggtcacgctg
ctcgcgattgtgcagcgcgacccggacggggacggcccgttggtgacgagcgtgttcgag
gccacggcgcacacgagcgccgtgcgcacctacacacggttgtgcagcgaggagccatat
ccagtggaggcggtgtcgtcgatgaacgcaacactgcccatggaagcggccaaactggag
gatgcgcaggcgcaggtctattggggagaaagctcgtgggactgcgagaacgcctggcaa
agcgccccgctgcgttccaccacgctgcgcgaccgcaaccaggtgatcaatccgggcatg
tcctccgcccgattcgcccgccgttccacctcgacgtggtccaccggcgaattcgagccg
atgggcatcgtcgaaggaggcggccgcccgggtgagctcggccatttctcattcgcatgg
cagatcgagcacaacggcgcctgggaatgggagatcggcgaggacgacccgggtctgcgc
gtgagcgcatacgggccggaatacgacgaccatcagtggttcatcatgctgcgcgacaac
cagcccttcgtcacggtgccggtctcgttcgtggtctgcgcgggcgactggcagcatgcc
gtggccgagatgaccgtgcagcggcgcgcgctctaccgggcgaaggccatggagatgggg
cgtctggagcaggccgaacaggcgaagggtctcgtggtctacaacgactacatgaacacg
ttgtggggagacccccgcatcgagaaggagctgccgcttgtggagggcgcggccaaggtg
ggcgccgacgtgttctgcatcgacgccgggtggtacgacagcgaggacggcggctggtgg
gacatggtgggtgaatggaaaccctccatgaaccgcttcggcgacatccgcctggccggc
ctcatccacgacatccagtcacacggcatgaaggccggcctgtggctggagccggaggtg
atcggcgtgcgctcgccgctggcgaagatgctgcccgactcggcgttcttctgccggcat
ggcgtccgcatcgccgatcagggccgctaccatctcgacttccgctcgccggtggcgcgc
gcccatgccacggccacggtggaccgcctgatcgacgagttcaatgtgaggttcttcaag
ttcgactacaacacgacgccgggtgccggcaccgatgtcgacacggattcggtgggcgag
ggcctgctcgagcattgccgcgcggtgcagcagtggatcgagcagatccgcgccaaacac
cccgacgtgatgatcgaaaactgcggttccggtgccatgagggccgactatgcgatgctg
agccgcctcgacatgcagtccacctccgaccagtccgatccactcgtctatgcggcgatc
gccgccggcgccggcatgacggtgcttccggagcagcagggcaactggggctatgcacag
caggagatggacgacgagaccgccgtgttcacgctggctgcaggcattctgggccgcctg
tacctctcggggttcatcgaccgcatggacgaggcgcggctgggcctggtgcgcgatgcg
atcgcactgcaccgcacgatcctgggcgggcaatcgcatctggtgccatggtggccctgt
gggttgccggacttcaacagcccttggctcgtgtatggtttgcggcatgcccccaatgtg
accgggctgtcgcatgacgaagactggaatggcactgacggccaaggctccgagcacgtc
gatgaggcccaatacctgaccatctggcgtcgtggcggcattaattcgctgtatttggag
attggtgagggagcccatatcgagcaggtgttccccaatccggccaagccggagcatgcg
cccgatgccaagccgtggcgcattgaatgggcggattccgagaccgtgcgcatcgaagcc
tccgcagacaaggagccctccgcacgtgtcttcgccatcacattcccgcagccatctgcc
gatggcacagcggatgacgatgccagcgagaacgccgggcacgatatcgaggggcgataa

DBGET integrated database retrieval system