KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_01675Help
Entry
BIF_01675         CDS       T01840                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bbb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616841..617797
Genome map
AA seq 318 aa AA seqDB search
MSAPNGARFQTPTLRADYASVHVDCPAKTNLTLHVGERREEWGGRHALETIYCGVGIYDT
VTVTAKEPGTGFSLDLAGTHLGDLAASTSDMRRNHAVLAMFAMAQASGHEPDVSISIEKR
IPVAAGLGGGSADAAGTLLALNALWNLNWPVARLREIAAALGADMPFCVTGGLALGTGFG
ERIKDLTASDPRIEHAVGDLFADAPSGDGVHMLVGAYLSQLSTPEVYSTFDVLGAGEGDL
NELQHAAVSLHPRSGVAIREAQQAGATSAFVSGSGPTVIAVVPDDRVREATRAAWQASGA
VDRIIDAQAPAAPLMRAE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacccaacggcgcccgattccagacccccacgctccgcgcagactacgccagc
gtgcatgtggactgccctgccaagacgaatctcacattgcatgtgggggaacgccgtgag
gaatggggcggcagacatgccttggagaccatctactgcggcgtgggtatctacgacacg
gtgacggtgaccgccaaggaaccgggcaccggcttctccctcgatctcgccggcactcat
ttgggagatctggccgcgtcgacgagcgatatgcgcaggaaccacgccgtgcttgccatg
ttcgcgatggcgcaggccagcgggcacgaacctgacgtctccattagcatagagaagcgc
attcccgtcgcagccggtctgggaggcgggtcggcggatgcggcgggcacactgctcgcg
ctcaatgcgttgtggaatctcaattggccggtggcacgactccgcgagatagcggccgcc
ttgggcgccgacatgccgttctgcgtcaccggcggcctggcgttgggcaccggcttcggc
gagcgtataaaggatctgaccgcatccgacccgcgtatcgaacatgcggtgggcgatctg
ttcgcagatgccccttccggcgatggcgtgcacatgctcgtcggcgcatacctgtcgcag
ctgagcacgccagaagtctactccaccttcgacgtgctcggcgcaggagaaggcgacctc
aacgagttgcagcacgccgccgtctcgctgcatccgcgcagcggcgtggccatccgcgaa
gctcagcaggcgggcgcgacgagtgccttcgtctccggatctggccctactgtaatcgcc
gtggtgcctgacgaccgggtgcgcgaggcgacgcgcgcggcatggcaggcttccggggcc
gtcgaccgcatcatcgatgcacaggcaccggccgcaccgctcatgcgagccgagtag

DBGET integrated database retrieval system